BLASTX nr result
ID: Rehmannia32_contig00023286
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00023286 (381 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012858641.1| PREDICTED: uncharacterized protein LOC105977... 57 5e-07 >ref|XP_012858641.1| PREDICTED: uncharacterized protein LOC105977806 [Erythranthe guttata] Length = 344 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/50 (48%), Positives = 36/50 (72%) Frame = +2 Query: 179 MPKGVPKEPKSRSENARWPIQNERLLIEFMHDEFLQGQLLTSTFSSYVLG 328 M + V + + R ENA+WP +E +L++ +D +LQGQLLT+TFSS+V G Sbjct: 64 MSRSVNSDKQPRCENAQWPFSSEEMLVQVCYDSYLQGQLLTTTFSSFVWG 113