BLASTX nr result
ID: Rehmannia32_contig00023077
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00023077 (661 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019184983.1| PREDICTED: uncharacterized protein LOC109179... 59 3e-07 >ref|XP_019184983.1| PREDICTED: uncharacterized protein LOC109179963 [Ipomoea nil] Length = 156 Score = 58.5 bits (140), Expect = 3e-07 Identities = 25/40 (62%), Positives = 28/40 (70%), Gaps = 2/40 (5%) Frame = +3 Query: 522 VGSFWISATIFSF--IGDWWYLSCKKCPKKLAQAGEKLYC 635 VGS+W+ ATI IGDWWYLSCK+CP KL QA YC Sbjct: 77 VGSYWVLATILPIQTIGDWWYLSCKRCPIKLEQASNCFYC 116