BLASTX nr result
ID: Rehmannia32_contig00023021
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00023021 (753 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38873.1| hypothetical protein MIMGU_mgv1a002218mg [Erythra... 67 8e-09 >gb|EYU38873.1| hypothetical protein MIMGU_mgv1a002218mg [Erythranthe guttata] Length = 700 Score = 66.6 bits (161), Expect = 8e-09 Identities = 33/55 (60%), Positives = 39/55 (70%) Frame = -1 Query: 231 MSIPSLSHAIAIFRFLLHCFRGLSQRKITNPFSLECPSLTPRRPPFLFLIGLCVV 67 MSIP+ HAIAI FLLH FR L + +ITNPF ECPS+ R PP FLIGL ++ Sbjct: 1 MSIPNQPHAIAIVGFLLHSFRCLFRPRITNPFLQECPSVIRRPPPLFFLIGLWLI 55