BLASTX nr result
ID: Rehmannia32_contig00022948
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00022948 (514 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011079038.1| frataxin, mitochondrial [Sesamum indicum] 69 4e-11 gb|PIN04315.1| Mitochondrial matrix protein frataxin, involved i... 65 9e-10 ref|XP_010035636.1| PREDICTED: frataxin, mitochondrial [Eucalypt... 64 2e-09 ref|XP_022852513.1| frataxin, mitochondrial-like [Olea europaea ... 63 6e-09 emb|CDP11870.1| unnamed protein product [Coffea canephora] 62 9e-09 ref|XP_019078821.1| PREDICTED: frataxin, mitochondrial isoform X... 62 1e-08 ref|XP_022865731.1| frataxin, mitochondrial-like isoform X2 [Ole... 60 1e-08 ref|XP_002277091.1| PREDICTED: frataxin, mitochondrial isoform X... 62 1e-08 emb|CAN67530.1| hypothetical protein VITISV_004311 [Vitis vinifera] 62 1e-08 ref|XP_022860045.1| frataxin, mitochondrial-like [Olea europaea ... 61 3e-08 ref|XP_023533562.1| frataxin, mitochondrial isoform X2 [Cucurbit... 61 3e-08 ref|XP_023533560.1| frataxin, mitochondrial isoform X1 [Cucurbit... 61 4e-08 ref|XP_022865730.1| frataxin, mitochondrial-like isoform X1 [Ole... 60 4e-08 ref|XP_021906595.1| frataxin, mitochondrial [Carica papaya] >gi|... 60 8e-08 ref|XP_022947402.1| frataxin, mitochondrial [Cucurbita moschata] 60 9e-08 ref|XP_017183959.1| PREDICTED: frataxin, mitochondrial-like [Mal... 58 1e-07 ref|XP_022971111.1| frataxin, mitochondrial [Cucurbita maxima] 59 1e-07 ref|XP_004293478.1| PREDICTED: frataxin, mitochondrial [Fragaria... 59 1e-07 gb|PIA45824.1| hypothetical protein AQUCO_01600218v1 [Aquilegia ... 59 2e-07 ref|XP_009341459.1| PREDICTED: frataxin, mitochondrial-like [Pyr... 58 3e-07 >ref|XP_011079038.1| frataxin, mitochondrial [Sesamum indicum] Length = 190 Score = 68.6 bits (166), Expect = 4e-11 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +1 Query: 1 WDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 108 WDQ+AQAWIYRRTK+NLI VLETELEKLC +PISLS Sbjct: 155 WDQNAQAWIYRRTKENLIQVLETELEKLCGQPISLS 190 >gb|PIN04315.1| Mitochondrial matrix protein frataxin, involved in Fe/S protein biosynthesis [Handroanthus impetiginosus] Length = 195 Score = 65.1 bits (157), Expect = 9e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 1 WDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 108 WD DAQAWIYRRTK NLI VLE+ELEKLC +PISLS Sbjct: 160 WDHDAQAWIYRRTKGNLIKVLESELEKLCGEPISLS 195 >ref|XP_010035636.1| PREDICTED: frataxin, mitochondrial [Eucalyptus grandis] gb|KCW47082.1| hypothetical protein EUGRSUZ_K00886 [Eucalyptus grandis] Length = 189 Score = 63.9 bits (154), Expect = 2e-09 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = +1 Query: 1 WDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 108 WDQ++Q+W+YRRTK NL+ VLETELEKLC +PISLS Sbjct: 154 WDQESQSWVYRRTKANLLKVLETELEKLCGQPISLS 189 >ref|XP_022852513.1| frataxin, mitochondrial-like [Olea europaea var. sylvestris] Length = 190 Score = 62.8 bits (151), Expect = 6e-09 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = +1 Query: 1 WDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 108 WDQ+ QAWIYRRTK+NLI+VLETELE+LC K I+LS Sbjct: 153 WDQNTQAWIYRRTKRNLINVLETELEQLCGKSINLS 188 >emb|CDP11870.1| unnamed protein product [Coffea canephora] Length = 198 Score = 62.4 bits (150), Expect = 9e-09 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +1 Query: 1 WDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 108 WDQD QAW+YRRTK NL+ +LE ELE+LC KPI+LS Sbjct: 163 WDQDTQAWVYRRTKANLLDILEEELEQLCGKPINLS 198 >ref|XP_019078821.1| PREDICTED: frataxin, mitochondrial isoform X2 [Vitis vinifera] Length = 181 Score = 62.0 bits (149), Expect = 1e-08 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +1 Query: 1 WDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 108 WDQ AQAW+YRRTK NL +LETELEKLC PISLS Sbjct: 146 WDQSAQAWVYRRTKANLSKLLETELEKLCGTPISLS 181 >ref|XP_022865731.1| frataxin, mitochondrial-like isoform X2 [Olea europaea var. sylvestris] Length = 118 Score = 60.5 bits (145), Expect = 1e-08 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +1 Query: 1 WDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 108 WDQ+ QAWIYRRTK+N I VLETELE+LC K I+LS Sbjct: 81 WDQNTQAWIYRRTKRNFIKVLETELEQLCGKSINLS 116 >ref|XP_002277091.1| PREDICTED: frataxin, mitochondrial isoform X1 [Vitis vinifera] emb|CBI17994.3| unnamed protein product, partial [Vitis vinifera] Length = 197 Score = 62.0 bits (149), Expect = 1e-08 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +1 Query: 1 WDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 108 WDQ AQAW+YRRTK NL +LETELEKLC PISLS Sbjct: 162 WDQSAQAWVYRRTKANLSKLLETELEKLCGTPISLS 197 >emb|CAN67530.1| hypothetical protein VITISV_004311 [Vitis vinifera] Length = 202 Score = 62.0 bits (149), Expect = 1e-08 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +1 Query: 1 WDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 108 WDQ AQAW+YRRTK NL +LETELEKLC PISLS Sbjct: 167 WDQSAQAWVYRRTKANLSKLLETELEKLCGTPISLS 202 >ref|XP_022860045.1| frataxin, mitochondrial-like [Olea europaea var. sylvestris] Length = 190 Score = 60.8 bits (146), Expect = 3e-08 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +1 Query: 1 WDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 108 WD++AQAWIYRRTK NLI VLETELE+LC K I+LS Sbjct: 153 WDKNAQAWIYRRTKGNLIKVLETELEQLCGKSINLS 188 >ref|XP_023533562.1| frataxin, mitochondrial isoform X2 [Cucurbita pepo subsp. pepo] Length = 196 Score = 60.8 bits (146), Expect = 3e-08 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +1 Query: 1 WDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 108 WDQD+QAWIYRR K NL+ +LETEL +LC KPI+LS Sbjct: 161 WDQDSQAWIYRRNKANLLRLLETELAQLCGKPINLS 196 >ref|XP_023533560.1| frataxin, mitochondrial isoform X1 [Cucurbita pepo subsp. pepo] Length = 203 Score = 60.8 bits (146), Expect = 4e-08 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +1 Query: 1 WDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 108 WDQD+QAWIYRR K NL+ +LETEL +LC KPI+LS Sbjct: 168 WDQDSQAWIYRRNKANLLRLLETELAQLCGKPINLS 203 >ref|XP_022865730.1| frataxin, mitochondrial-like isoform X1 [Olea europaea var. sylvestris] Length = 189 Score = 60.5 bits (145), Expect = 4e-08 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +1 Query: 1 WDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 108 WDQ+ QAWIYRRTK+N I VLETELE+LC K I+LS Sbjct: 152 WDQNTQAWIYRRTKRNFIKVLETELEQLCGKSINLS 187 >ref|XP_021906595.1| frataxin, mitochondrial [Carica papaya] ref|XP_021906596.1| frataxin, mitochondrial [Carica papaya] Length = 190 Score = 59.7 bits (143), Expect = 8e-08 Identities = 24/36 (66%), Positives = 32/36 (88%) Frame = +1 Query: 1 WDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 108 WDQ+ QAW+YRRTK NL+ +LE+E+EKLC KPI+L+ Sbjct: 155 WDQNLQAWVYRRTKANLLELLESEVEKLCGKPINLA 190 >ref|XP_022947402.1| frataxin, mitochondrial [Cucurbita moschata] Length = 196 Score = 59.7 bits (143), Expect = 9e-08 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = +1 Query: 1 WDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 108 WDQD+QAWIYRR+K NL+ +LETEL +LC +PI+LS Sbjct: 161 WDQDSQAWIYRRSKANLLRLLETELTQLCGEPINLS 196 >ref|XP_017183959.1| PREDICTED: frataxin, mitochondrial-like [Malus domestica] Length = 130 Score = 58.2 bits (139), Expect = 1e-07 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +1 Query: 1 WDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 108 WD+ AQAW+YRRTK L+ +LE+ELE+LC +PISLS Sbjct: 95 WDRSAQAWVYRRTKARLLKILESELEELCGEPISLS 130 >ref|XP_022971111.1| frataxin, mitochondrial [Cucurbita maxima] Length = 196 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +1 Query: 1 WDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 108 WDQD+QAWIYRR K NL+ +LETEL +LC +PI+LS Sbjct: 161 WDQDSQAWIYRRNKANLLRLLETELAQLCGEPINLS 196 >ref|XP_004293478.1| PREDICTED: frataxin, mitochondrial [Fragaria vesca subsp. vesca] Length = 187 Score = 58.9 bits (141), Expect = 1e-07 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = +1 Query: 1 WDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 108 WD+DA+AWIYRRTK L+ +LETE+E+LC +PISLS Sbjct: 152 WDRDAEAWIYRRTKVKLLTLLETEMEQLCGEPISLS 187 >gb|PIA45824.1| hypothetical protein AQUCO_01600218v1 [Aquilegia coerulea] Length = 192 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = +1 Query: 1 WDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 108 WD+ +QAW+YRRTK NL+ + E ELEKLC +PISLS Sbjct: 157 WDRSSQAWVYRRTKANLLQLFENELEKLCGEPISLS 192 >ref|XP_009341459.1| PREDICTED: frataxin, mitochondrial-like [Pyrus x bretschneideri] Length = 195 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +1 Query: 1 WDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 108 WD+ A+AW+YRRTK L+ +LE+ELEKLC +PISLS Sbjct: 160 WDRSARAWVYRRTKARLLKILESELEKLCGEPISLS 195