BLASTX nr result
ID: Rehmannia32_contig00022845
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00022845 (442 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011095625.1| uncharacterized protein LOC105175024 [Sesamu... 78 1e-14 ref|XP_012849347.1| PREDICTED: uncharacterized protein LOC105969... 72 2e-12 ref|XP_022855195.1| uncharacterized protein LOC111376467 [Olea e... 70 6e-12 gb|KZV36228.1| hypothetical protein F511_14246 [Dorcoceras hygro... 68 4e-11 gb|PIN15018.1| hypothetical protein CDL12_12344 [Handroanthus im... 65 8e-10 gb|PIN24406.1| hypothetical protein CDL12_02860 [Handroanthus im... 64 1e-09 ref|XP_007020330.1| PREDICTED: uncharacterized protein LOC185931... 64 2e-09 gb|PIN04951.1| hypothetical protein CDL12_22511 [Handroanthus im... 64 2e-09 ref|XP_002274782.1| PREDICTED: uncharacterized protein LOC100251... 64 2e-09 gb|PIN21426.1| hypothetical protein CDL12_05850 [Handroanthus im... 62 8e-09 ref|XP_002299072.1| hypothetical protein POPTR_0001s47470g [Popu... 62 1e-08 ref|XP_021612480.1| uncharacterized protein LOC110615083 [Maniho... 61 2e-08 ref|XP_023891806.1| uncharacterized protein LOC112003820 [Quercu... 61 2e-08 gb|PIN19567.1| hypothetical protein CDL12_07766 [Handroanthus im... 60 3e-08 ref|XP_011039859.1| PREDICTED: uncharacterized protein LOC105136... 60 5e-08 ref|XP_008813753.1| PREDICTED: uncharacterized protein LOC103724... 60 5e-08 ref|XP_010061401.1| PREDICTED: uncharacterized protein LOC104449... 60 5e-08 gb|PIA45547.1| hypothetical protein AQUCO_01600028v1 [Aquilegia ... 60 6e-08 ref|XP_021906051.1| uncharacterized protein LOC110820777 [Carica... 60 6e-08 ref|XP_002532941.1| PREDICTED: uncharacterized protein LOC827654... 60 7e-08 >ref|XP_011095625.1| uncharacterized protein LOC105175024 [Sesamum indicum] ref|XP_011095626.1| uncharacterized protein LOC105175024 [Sesamum indicum] Length = 218 Score = 77.8 bits (190), Expect = 1e-14 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = +2 Query: 2 KWRPLTWCSQYRVTVFLVCFTGLVLPSCRFILCA 103 KWRPLTWCS YRVTVFLVCFTGLVLPSCRFILCA Sbjct: 185 KWRPLTWCSHYRVTVFLVCFTGLVLPSCRFILCA 218 >ref|XP_012849347.1| PREDICTED: uncharacterized protein LOC105969150 [Erythranthe guttata] gb|EYU27502.1| hypothetical protein MIMGU_mgv1a013402mg [Erythranthe guttata] Length = 221 Score = 72.0 bits (175), Expect = 2e-12 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = +2 Query: 2 KWRPLTWCSQYRVTVFLVCFTGLVLPSCRFILCA 103 KWRPLTWCS YRVTVFL CF GLVLP CRFILCA Sbjct: 188 KWRPLTWCSNYRVTVFLFCFAGLVLPCCRFILCA 221 >ref|XP_022855195.1| uncharacterized protein LOC111376467 [Olea europaea var. sylvestris] Length = 221 Score = 70.5 bits (171), Expect = 6e-12 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = +2 Query: 2 KWRPLTWCSQYRVTVFLVCFTGLVLPSCRFILCA 103 KW+PLTWCSQYR+T+ L+CFTGL+ P+CRFILCA Sbjct: 188 KWKPLTWCSQYRITICLLCFTGLIFPACRFILCA 221 >gb|KZV36228.1| hypothetical protein F511_14246 [Dorcoceras hygrometricum] Length = 214 Score = 68.2 bits (165), Expect = 4e-11 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +2 Query: 2 KWRPLTWCSQYRVTVFLVCFTGLVLPSCRFILCA 103 KWRPLTWC+QY TV LVCFTGLV P+CRFILCA Sbjct: 179 KWRPLTWCTQYCATVCLVCFTGLVFPACRFILCA 212 >gb|PIN15018.1| hypothetical protein CDL12_12344 [Handroanthus impetiginosus] Length = 214 Score = 64.7 bits (156), Expect = 8e-10 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +2 Query: 2 KWRPLTWCSQYRVTVFLVCFTGLVLPSCRFILCA 103 K RPLTWC YRVT FLVCFTGLV+PSCR ILCA Sbjct: 181 KRRPLTWCYHYRVTAFLVCFTGLVVPSCRVILCA 214 >gb|PIN24406.1| hypothetical protein CDL12_02860 [Handroanthus impetiginosus] Length = 202 Score = 64.3 bits (155), Expect = 1e-09 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +2 Query: 2 KWRPLTWCSQYRVTVFLVCFTGLVLPSCRFILCA 103 K RPLTWCS YRVT FLVCFTGLV+PSCRFI+ A Sbjct: 169 KRRPLTWCSHYRVTAFLVCFTGLVVPSCRFIVYA 202 >ref|XP_007020330.1| PREDICTED: uncharacterized protein LOC18593183 [Theobroma cacao] ref|XP_007020331.1| PREDICTED: uncharacterized protein LOC18593183 [Theobroma cacao] gb|EOY11855.1| RNA polymerase II elongation factor ELL3 isoform 1 [Theobroma cacao] gb|EOY11856.1| RNA polymerase II elongation factor ELL3 isoform 1 [Theobroma cacao] Length = 222 Score = 63.9 bits (154), Expect = 2e-09 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = +2 Query: 2 KWRPLTWCSQYRVTVFLVCFTGLVLPSCRFILC 100 KW+PLTWCSQY +T+ LVCF+GLV P+C+F+LC Sbjct: 188 KWKPLTWCSQYLITLCLVCFSGLVFPACKFVLC 220 >gb|PIN04951.1| hypothetical protein CDL12_22511 [Handroanthus impetiginosus] Length = 214 Score = 63.5 bits (153), Expect = 2e-09 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +2 Query: 2 KWRPLTWCSQYRVTVFLVCFTGLVLPSCRFILCA 103 K +PLTWCS YRVT FLVCFTGLV+P CR ILCA Sbjct: 181 KRKPLTWCSHYRVTAFLVCFTGLVVPFCRVILCA 214 >ref|XP_002274782.1| PREDICTED: uncharacterized protein LOC100251512 [Vitis vinifera] Length = 221 Score = 63.5 bits (153), Expect = 2e-09 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = +2 Query: 2 KWRPLTWCSQYRVTVFLVCFTGLVLPSCRFILCA 103 KWRPL WCSQ +T+ LVCFTGLV+P+C+FILC+ Sbjct: 188 KWRPLVWCSQNLITICLVCFTGLVIPACKFILCS 221 >gb|PIN21426.1| hypothetical protein CDL12_05850 [Handroanthus impetiginosus] Length = 214 Score = 62.0 bits (149), Expect = 8e-09 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +2 Query: 2 KWRPLTWCSQYRVTVFLVCFTGLVLPSCRFILCA 103 K +P TWCS YRVT FLVCFTGLV+P CR ILCA Sbjct: 181 KRKPFTWCSHYRVTAFLVCFTGLVVPFCRVILCA 214 >ref|XP_002299072.1| hypothetical protein POPTR_0001s47470g [Populus trichocarpa] ref|XP_006370791.1| hypothetical protein POPTR_0001s47470g [Populus trichocarpa] gb|PNT60390.1| hypothetical protein POPTR_001G470800v3 [Populus trichocarpa] gb|PNT60391.1| hypothetical protein POPTR_001G470800v3 [Populus trichocarpa] Length = 219 Score = 61.6 bits (148), Expect = 1e-08 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = +2 Query: 2 KWRPLTWCSQYRVTVFLVCFTGLVLPSCRFILC 100 KW+PLTWCSQY +T+ LVCFTGLV P+ +F+LC Sbjct: 187 KWKPLTWCSQYLITICLVCFTGLVFPASKFMLC 219 >ref|XP_021612480.1| uncharacterized protein LOC110615083 [Manihot esculenta] gb|OAY51325.1| hypothetical protein MANES_05G205500 [Manihot esculenta] Length = 221 Score = 61.2 bits (147), Expect = 2e-08 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = +2 Query: 2 KWRPLTWCSQYRVTVFLVCFTGLVLPSCRFILC 100 KW+PLTWCSQY +T+ LVCF+GLV P+ +FILC Sbjct: 187 KWKPLTWCSQYLITICLVCFSGLVFPASKFILC 219 >ref|XP_023891806.1| uncharacterized protein LOC112003820 [Quercus suber] gb|POE61513.1| hypothetical protein CFP56_21480 [Quercus suber] Length = 222 Score = 61.2 bits (147), Expect = 2e-08 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = +2 Query: 2 KWRPLTWCSQYRVTVFLVCFTGLVLPSCRFILC 100 KW+PLTWCSQY +T+ LVCFTGLV P+ FI+C Sbjct: 188 KWKPLTWCSQYLITIALVCFTGLVFPASEFIIC 220 >gb|PIN19567.1| hypothetical protein CDL12_07766 [Handroanthus impetiginosus] Length = 214 Score = 60.5 bits (145), Expect = 3e-08 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +2 Query: 2 KWRPLTWCSQYRVTVFLVCFTGLVLPSCRFILCA 103 K + LTWCS YRVT FLVCFTGLV+P CR ILCA Sbjct: 181 KRKTLTWCSHYRVTAFLVCFTGLVVPFCRVILCA 214 >ref|XP_011039859.1| PREDICTED: uncharacterized protein LOC105136277 [Populus euphratica] ref|XP_011039860.1| PREDICTED: uncharacterized protein LOC105136277 [Populus euphratica] Length = 219 Score = 60.1 bits (144), Expect = 5e-08 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = +2 Query: 2 KWRPLTWCSQYRVTVFLVCFTGLVLPSCRFILC 100 KW+PLTWC QY +T+ LVCFTGLV P+ +F+LC Sbjct: 187 KWKPLTWCQQYLITICLVCFTGLVFPASKFMLC 219 >ref|XP_008813753.1| PREDICTED: uncharacterized protein LOC103724311 [Phoenix dactylifera] Length = 222 Score = 60.1 bits (144), Expect = 5e-08 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = +2 Query: 2 KWRPLTWCSQYRVTVFLVCFTGLVLPSCRFILC 100 KWRPL WCSQ VT+ L+CFTG++ P+C+FILC Sbjct: 189 KWRPLRWCSQNLVTICLLCFTGMIFPACKFILC 221 >ref|XP_010061401.1| PREDICTED: uncharacterized protein LOC104449079 [Eucalyptus grandis] gb|KCW68338.1| hypothetical protein EUGRSUZ_F02000 [Eucalyptus grandis] Length = 228 Score = 60.1 bits (144), Expect = 5e-08 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +2 Query: 2 KWRPLTWCSQYRVTVFLVCFTGLVLPSCRFILC 100 KWRPLTWCSQ VTV L+CFTGLV P+ +FILC Sbjct: 196 KWRPLTWCSQNAVTVCLLCFTGLVAPASKFILC 228 >gb|PIA45547.1| hypothetical protein AQUCO_01600028v1 [Aquilegia coerulea] gb|PIA45548.1| hypothetical protein AQUCO_01600028v1 [Aquilegia coerulea] gb|PIA45549.1| hypothetical protein AQUCO_01600028v1 [Aquilegia coerulea] Length = 217 Score = 59.7 bits (143), Expect = 6e-08 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = +2 Query: 2 KWRPLTWCSQYRVTVFLVCFTGLVLPSCRFILC 100 KW+PLTWCSQY VT+ LVCF G+V+P +FILC Sbjct: 184 KWKPLTWCSQYLVTICLVCFAGMVVPVSKFILC 216 >ref|XP_021906051.1| uncharacterized protein LOC110820777 [Carica papaya] ref|XP_021906052.1| uncharacterized protein LOC110820777 [Carica papaya] ref|XP_021906053.1| uncharacterized protein LOC110820777 [Carica papaya] ref|XP_021906054.1| uncharacterized protein LOC110820777 [Carica papaya] ref|XP_021906055.1| uncharacterized protein LOC110820777 [Carica papaya] ref|XP_021906056.1| uncharacterized protein LOC110820777 [Carica papaya] Length = 219 Score = 59.7 bits (143), Expect = 6e-08 Identities = 21/33 (63%), Positives = 28/33 (84%) Frame = +2 Query: 2 KWRPLTWCSQYRVTVFLVCFTGLVLPSCRFILC 100 KW+P+TWCSQY +T+ LVCF GLV P+ +F+LC Sbjct: 185 KWKPVTWCSQYLITIVLVCFAGLVFPASKFVLC 217 >ref|XP_002532941.1| PREDICTED: uncharacterized protein LOC8276546 [Ricinus communis] gb|EEF29445.1| conserved hypothetical protein [Ricinus communis] Length = 220 Score = 59.7 bits (143), Expect = 7e-08 Identities = 22/33 (66%), Positives = 29/33 (87%) Frame = +2 Query: 2 KWRPLTWCSQYRVTVFLVCFTGLVLPSCRFILC 100 KW+P+TWCSQY VT+ LVCF+GL+ P+ +FILC Sbjct: 186 KWKPITWCSQYLVTICLVCFSGLLFPASKFILC 218