BLASTX nr result
ID: Rehmannia32_contig00022708
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00022708 (523 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097605.1| histone acetyltransferase KAT6A [Sesamum ind... 49 4e-07 >ref|XP_011097605.1| histone acetyltransferase KAT6A [Sesamum indicum] Length = 898 Score = 48.5 bits (114), Expect(3) = 4e-07 Identities = 29/65 (44%), Positives = 39/65 (60%), Gaps = 3/65 (4%) Frame = -3 Query: 383 FLYCVGLRLSL-S*EYT*VS--SFELKLYIS*TDWISQFLPAADDSLFILMDEKLIKDSC 213 F+ CV +RL L S EY +F LKLYI+ DW+SQF + +ILMDE+L SC Sbjct: 819 FMDCVRVRLRLLSLEYVSFEFCTFGLKLYIARPDWVSQFSQPQTTAFYILMDERLCFKSC 878 Query: 212 LKYAL 198 + + L Sbjct: 879 INFRL 883 Score = 27.3 bits (59), Expect(3) = 4e-07 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -1 Query: 451 RSAGVACRMFELR 413 +SAGVACRMF+LR Sbjct: 793 QSAGVACRMFQLR 805 Score = 25.0 bits (53), Expect(3) = 4e-07 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -2 Query: 204 CVNF*VGDSGCCLVVC 157 C+NF + + G CLVVC Sbjct: 878 CINFRLENCGWCLVVC 893