BLASTX nr result
ID: Rehmannia32_contig00022652
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00022652 (398 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011089861.2| interactor of constitutive active ROPs 3 [Se... 57 9e-07 gb|KZV48538.1| interactor of constitutive active ROPs 3 [Dorcoce... 55 4e-06 >ref|XP_011089861.2| interactor of constitutive active ROPs 3 [Sesamum indicum] ref|XP_020552496.1| interactor of constitutive active ROPs 3 [Sesamum indicum] ref|XP_020552497.1| interactor of constitutive active ROPs 3 [Sesamum indicum] ref|XP_020552498.1| interactor of constitutive active ROPs 3 [Sesamum indicum] ref|XP_020552499.1| interactor of constitutive active ROPs 3 [Sesamum indicum] ref|XP_020552500.1| interactor of constitutive active ROPs 3 [Sesamum indicum] Length = 634 Score = 57.0 bits (136), Expect = 9e-07 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 291 MQTPKARTSASGTPQKISPRSISSEVSQKNSSPQAA 398 MQTPKARTS+SG PQK SPRSISSE +QKN SPQAA Sbjct: 1 MQTPKARTSSSGAPQKNSPRSISSEATQKN-SPQAA 35 >gb|KZV48538.1| interactor of constitutive active ROPs 3 [Dorcoceras hygrometricum] Length = 627 Score = 55.1 bits (131), Expect = 4e-06 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = +3 Query: 291 MQTPKARTSASGTPQKISPRSISSEVSQKNSSPQA 395 MQTPKART++SG PQ+ SPR+ S+E +QKNSSPQA Sbjct: 1 MQTPKARTNSSGGPQRTSPRATSTEATQKNSSPQA 35