BLASTX nr result
ID: Rehmannia32_contig00022512
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00022512 (417 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|POO03326.1| TsaA-like domain containing protein [Trema orient... 56 2e-06 gb|PON52945.1| TsaA-like domain containing protein [Parasponia a... 56 2e-06 ref|XP_011079323.1| uncharacterized protein LOC105162867 isoform... 55 3e-06 >gb|POO03326.1| TsaA-like domain containing protein [Trema orientalis] Length = 406 Score = 56.2 bits (134), Expect = 2e-06 Identities = 27/46 (58%), Positives = 36/46 (78%), Gaps = 2/46 (4%) Frame = -2 Query: 416 DVVYHLILEGLNISYRIDSDSNVLVEKATLASLHSKSR*N--NYLT 285 D++YHLILEGL++SYR+D D NV+VEK + +S SK+ N NYLT Sbjct: 355 DIIYHLILEGLDVSYRVDFDGNVIVEKVSQSSTISKTNQNRSNYLT 400 >gb|PON52945.1| TsaA-like domain containing protein [Parasponia andersonii] Length = 406 Score = 56.2 bits (134), Expect = 2e-06 Identities = 27/46 (58%), Positives = 36/46 (78%), Gaps = 2/46 (4%) Frame = -2 Query: 416 DVVYHLILEGLNISYRIDSDSNVLVEKATLASLHSKSR*N--NYLT 285 D++YHLILEGL++SYR+D D NV+VEK + +S SK+ N NYLT Sbjct: 355 DIIYHLILEGLDVSYRVDFDGNVIVEKVSQSSTISKTNQNRPNYLT 400 >ref|XP_011079323.1| uncharacterized protein LOC105162867 isoform X1 [Sesamum indicum] Length = 389 Score = 55.5 bits (132), Expect = 3e-06 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -2 Query: 416 DVVYHLILEGLNISYRIDSDSNVLVEKATLAS 321 DVVYHLILEGL++SYRI+S++NVLVEK TLAS Sbjct: 348 DVVYHLILEGLDVSYRINSNANVLVEKVTLAS 379