BLASTX nr result
ID: Rehmannia32_contig00021280
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00021280 (442 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN13223.1| Serine/threonine protein kinase [Handroanthus imp... 63 1e-08 >gb|PIN13223.1| Serine/threonine protein kinase [Handroanthus impetiginosus] Length = 657 Score = 62.8 bits (151), Expect = 1e-08 Identities = 34/57 (59%), Positives = 39/57 (68%) Frame = -3 Query: 410 PAKGHTKTASSEMIKADITLTDGSMDHNHENFSRVSKVSSNDGHEIPNWWSKSSSCD 240 P KG +T SSEMI LTDGS+DH+HE SR SK SS+DGH P WSK+SS D Sbjct: 183 PVKGDRRTPSSEMI-----LTDGSVDHHHEITSRFSKNSSDDGHGNPYRWSKNSSVD 234