BLASTX nr result
ID: Rehmannia32_contig00021214
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00021214 (387 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631649.1| PREDICTED: cyclase-associated protein 1 [Vit... 105 7e-24 ref|XP_011088387.1| cyclase-associated protein 1 [Sesamum indicum] 101 2e-22 ref|XP_012837046.1| PREDICTED: cyclase-associated protein 1 [Ery... 100 5e-22 ref|XP_021731602.1| cyclase-associated protein 1-like [Chenopodi... 99 2e-21 ref|XP_015952019.1| cyclase-associated protein 1 [Arachis durane... 99 2e-21 ref|XP_016187012.1| cyclase-associated protein 1 [Arachis ipaensis] 99 2e-21 gb|KCW55347.1| hypothetical protein EUGRSUZ_I01265 [Eucalyptus g... 98 2e-21 ref|XP_022876272.1| cyclase-associated protein 1-like [Olea euro... 98 2e-21 gb|PIN24600.1| Adenylate cyclase-associated protein (CAP/Srv2p) ... 98 2e-21 ref|XP_010028583.1| PREDICTED: LOW QUALITY PROTEIN: cyclase-asso... 98 2e-21 ref|XP_018807064.1| PREDICTED: cyclase-associated protein 1-like... 98 3e-21 ref|XP_018847838.1| PREDICTED: cyclase-associated protein 1-like... 97 4e-21 ref|XP_012069926.1| cyclase-associated protein 1 [Jatropha curca... 97 4e-21 ref|XP_011092784.1| cyclase-associated protein 1 [Sesamum indicum] 97 6e-21 gb|OAY81888.1| Cyclase-associated protein 1 [Ananas comosus] 93 9e-21 ref|XP_021866816.1| cyclase-associated protein 1 [Spinacia olera... 96 1e-20 ref|XP_020081310.1| cyclase-associated protein 1-like [Ananas co... 92 2e-20 ref|XP_011037533.1| PREDICTED: cyclase-associated protein 1-like... 96 2e-20 gb|KRH29470.1| hypothetical protein GLYMA_11G118300 [Glycine max] 95 2e-20 ref|XP_002306100.1| cyclase associated protein 1 [Populus tricho... 95 3e-20 >ref|XP_003631649.1| PREDICTED: cyclase-associated protein 1 [Vitis vinifera] emb|CBI32583.3| unnamed protein product, partial [Vitis vinifera] Length = 472 Score = 105 bits (261), Expect = 7e-24 Identities = 49/53 (92%), Positives = 51/53 (96%) Frame = -3 Query: 385 EASITTAKSSEINVLVPGSEPDGDWIEQALPQQYVHVFKDGQFVTTPVSHSGG 227 EASITTAKSSEINVLVPG+EPDGDW E ALPQQY+HVFKDGQFVTTPVSHSGG Sbjct: 420 EASITTAKSSEINVLVPGAEPDGDWGEHALPQQYIHVFKDGQFVTTPVSHSGG 472 >ref|XP_011088387.1| cyclase-associated protein 1 [Sesamum indicum] Length = 472 Score = 101 bits (251), Expect = 2e-22 Identities = 46/53 (86%), Positives = 49/53 (92%) Frame = -3 Query: 385 EASITTAKSSEINVLVPGSEPDGDWIEQALPQQYVHVFKDGQFVTTPVSHSGG 227 EASITTAKSSEINVLVPG+EPDGDW+E ALPQQYVH +KDG F TTPVSHSGG Sbjct: 420 EASITTAKSSEINVLVPGAEPDGDWVEHALPQQYVHAYKDGHFETTPVSHSGG 472 >ref|XP_012837046.1| PREDICTED: cyclase-associated protein 1 [Erythranthe guttata] gb|EYU37793.1| hypothetical protein MIMGU_mgv1a005340mg [Erythranthe guttata] Length = 488 Score = 100 bits (248), Expect = 5e-22 Identities = 47/52 (90%), Positives = 48/52 (92%) Frame = -3 Query: 385 EASITTAKSSEINVLVPGSEPDGDWIEQALPQQYVHVFKDGQFVTTPVSHSG 230 E SITTAKSSEINVLVPGSEPDGDW E ALPQQYVH +KDGQFVTTPVSHSG Sbjct: 436 ETSITTAKSSEINVLVPGSEPDGDWGEHALPQQYVHAYKDGQFVTTPVSHSG 487 >ref|XP_021731602.1| cyclase-associated protein 1-like [Chenopodium quinoa] Length = 473 Score = 98.6 bits (244), Expect = 2e-21 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = -3 Query: 385 EASITTAKSSEINVLVPGSEPDGDWIEQALPQQYVHVFKDGQFVTTPVSHSGG 227 EASITTAKSSEINV+VP SE DGDW+E +LPQQY+H FKDGQFVT+PVSHSGG Sbjct: 421 EASITTAKSSEINVMVPASEADGDWVEHSLPQQYIHTFKDGQFVTSPVSHSGG 473 >ref|XP_015952019.1| cyclase-associated protein 1 [Arachis duranensis] Length = 474 Score = 98.6 bits (244), Expect = 2e-21 Identities = 43/53 (81%), Positives = 49/53 (92%) Frame = -3 Query: 385 EASITTAKSSEINVLVPGSEPDGDWIEQALPQQYVHVFKDGQFVTTPVSHSGG 227 E SI+TAKSSEINV+VPG+EPDGDW+E ALPQQY+HVFKDG+F TTP SHSGG Sbjct: 422 ETSISTAKSSEINVMVPGAEPDGDWVEHALPQQYIHVFKDGRFETTPASHSGG 474 >ref|XP_016187012.1| cyclase-associated protein 1 [Arachis ipaensis] Length = 477 Score = 98.6 bits (244), Expect = 2e-21 Identities = 43/53 (81%), Positives = 49/53 (92%) Frame = -3 Query: 385 EASITTAKSSEINVLVPGSEPDGDWIEQALPQQYVHVFKDGQFVTTPVSHSGG 227 E SI+TAKSSEINV+VPG+EPDGDW+E ALPQQY+HVFKDG+F TTP SHSGG Sbjct: 425 ETSISTAKSSEINVMVPGAEPDGDWVEHALPQQYIHVFKDGRFETTPASHSGG 477 >gb|KCW55347.1| hypothetical protein EUGRSUZ_I01265 [Eucalyptus grandis] Length = 427 Score = 98.2 bits (243), Expect = 2e-21 Identities = 44/52 (84%), Positives = 48/52 (92%) Frame = -3 Query: 382 ASITTAKSSEINVLVPGSEPDGDWIEQALPQQYVHVFKDGQFVTTPVSHSGG 227 ASITTAKSSEINVLVPG+EPD DW E +LPQQY+H +KDGQFVTTPVSHSGG Sbjct: 376 ASITTAKSSEINVLVPGAEPDSDWAEHSLPQQYIHAYKDGQFVTTPVSHSGG 427 >ref|XP_022876272.1| cyclase-associated protein 1-like [Olea europaea var. sylvestris] Length = 470 Score = 98.2 bits (243), Expect = 2e-21 Identities = 44/53 (83%), Positives = 48/53 (90%) Frame = -3 Query: 385 EASITTAKSSEINVLVPGSEPDGDWIEQALPQQYVHVFKDGQFVTTPVSHSGG 227 EAS+TTAKSSEINVLVPGS PD DW+E +LPQQYVH +KDG FVTTPVSHSGG Sbjct: 418 EASVTTAKSSEINVLVPGSGPDSDWVEHSLPQQYVHAYKDGHFVTTPVSHSGG 470 >gb|PIN24600.1| Adenylate cyclase-associated protein (CAP/Srv2p) [Handroanthus impetiginosus] Length = 474 Score = 98.2 bits (243), Expect = 2e-21 Identities = 45/51 (88%), Positives = 48/51 (94%) Frame = -3 Query: 382 ASITTAKSSEINVLVPGSEPDGDWIEQALPQQYVHVFKDGQFVTTPVSHSG 230 ASITTAKSSEINVLVPG E DGDW+E ALPQQY+HV+KDGQFVTTPVSHSG Sbjct: 423 ASITTAKSSEINVLVPGPETDGDWVETALPQQYIHVYKDGQFVTTPVSHSG 473 >ref|XP_010028583.1| PREDICTED: LOW QUALITY PROTEIN: cyclase-associated protein 1 [Eucalyptus grandis] Length = 477 Score = 98.2 bits (243), Expect = 2e-21 Identities = 44/52 (84%), Positives = 48/52 (92%) Frame = -3 Query: 382 ASITTAKSSEINVLVPGSEPDGDWIEQALPQQYVHVFKDGQFVTTPVSHSGG 227 ASITTAKSSEINVLVPG+EPD DW E +LPQQY+H +KDGQFVTTPVSHSGG Sbjct: 426 ASITTAKSSEINVLVPGAEPDSDWAEHSLPQQYIHAYKDGQFVTTPVSHSGG 477 >ref|XP_018807064.1| PREDICTED: cyclase-associated protein 1-like [Juglans regia] Length = 470 Score = 97.8 bits (242), Expect = 3e-21 Identities = 46/52 (88%), Positives = 48/52 (92%) Frame = -3 Query: 382 ASITTAKSSEINVLVPGSEPDGDWIEQALPQQYVHVFKDGQFVTTPVSHSGG 227 ASITTAKSSEINVLVPG+EPDGDW E ALPQQ+VHVFKDG F TTPVSHSGG Sbjct: 419 ASITTAKSSEINVLVPGAEPDGDWGEHALPQQFVHVFKDGHFETTPVSHSGG 470 >ref|XP_018847838.1| PREDICTED: cyclase-associated protein 1-like [Juglans regia] Length = 470 Score = 97.4 bits (241), Expect = 4e-21 Identities = 45/52 (86%), Positives = 48/52 (92%) Frame = -3 Query: 382 ASITTAKSSEINVLVPGSEPDGDWIEQALPQQYVHVFKDGQFVTTPVSHSGG 227 ASITTAKSSEINVLVPG+EPDGDW E ALPQQ++HVFKDG F TTPVSHSGG Sbjct: 419 ASITTAKSSEINVLVPGAEPDGDWGEHALPQQFIHVFKDGHFETTPVSHSGG 470 >ref|XP_012069926.1| cyclase-associated protein 1 [Jatropha curcas] gb|KDP46247.1| hypothetical protein JCGZ_10087 [Jatropha curcas] Length = 474 Score = 97.4 bits (241), Expect = 4e-21 Identities = 42/51 (82%), Positives = 48/51 (94%) Frame = -3 Query: 379 SITTAKSSEINVLVPGSEPDGDWIEQALPQQYVHVFKDGQFVTTPVSHSGG 227 SITTAKSSE+NVLVPG++PDGDW+E ALPQQY+H+FKDG F TTPVSHSGG Sbjct: 424 SITTAKSSEVNVLVPGAQPDGDWVEHALPQQYIHLFKDGHFETTPVSHSGG 474 >ref|XP_011092784.1| cyclase-associated protein 1 [Sesamum indicum] Length = 467 Score = 97.1 bits (240), Expect = 6e-21 Identities = 45/53 (84%), Positives = 48/53 (90%) Frame = -3 Query: 385 EASITTAKSSEINVLVPGSEPDGDWIEQALPQQYVHVFKDGQFVTTPVSHSGG 227 EASITTAKSSE+NVLVP SE DGDW E +LPQQY HV+KDGQFVTTPVSHSGG Sbjct: 415 EASITTAKSSEVNVLVPASESDGDWGEHSLPQQYAHVYKDGQFVTTPVSHSGG 467 >gb|OAY81888.1| Cyclase-associated protein 1 [Ananas comosus] Length = 232 Score = 93.2 bits (230), Expect = 9e-21 Identities = 41/52 (78%), Positives = 46/52 (88%) Frame = -3 Query: 382 ASITTAKSSEINVLVPGSEPDGDWIEQALPQQYVHVFKDGQFVTTPVSHSGG 227 ASITTAKSSEINV+VP PDGDW+E ALPQQY+H +KDGQF T+PVSHSGG Sbjct: 181 ASITTAKSSEINVMVPSGGPDGDWVEHALPQQYIHSYKDGQFTTSPVSHSGG 232 >ref|XP_021866816.1| cyclase-associated protein 1 [Spinacia oleracea] ref|XP_021840015.1| cyclase-associated protein 1-like [Spinacia oleracea] gb|KNA12973.1| hypothetical protein SOVF_121010 [Spinacia oleracea] Length = 470 Score = 95.9 bits (237), Expect = 1e-20 Identities = 44/53 (83%), Positives = 48/53 (90%) Frame = -3 Query: 385 EASITTAKSSEINVLVPGSEPDGDWIEQALPQQYVHVFKDGQFVTTPVSHSGG 227 EASITTAKSSEINV+VP SE DGDW E +LPQQY+H FKDGQFVT+PVSHSGG Sbjct: 418 EASITTAKSSEINVMVPASEADGDWGEHSLPQQYIHTFKDGQFVTSPVSHSGG 470 >ref|XP_020081310.1| cyclase-associated protein 1-like [Ananas comosus] Length = 222 Score = 92.4 bits (228), Expect = 2e-20 Identities = 41/53 (77%), Positives = 46/53 (86%) Frame = -3 Query: 385 EASITTAKSSEINVLVPGSEPDGDWIEQALPQQYVHVFKDGQFVTTPVSHSGG 227 E SITTAKSSE+NVLVPG+ PDGDW+E LPQQ+VH FKD QF T+PVSHSGG Sbjct: 170 ETSITTAKSSEVNVLVPGAGPDGDWVEHPLPQQFVHTFKDRQFTTSPVSHSGG 222 >ref|XP_011037533.1| PREDICTED: cyclase-associated protein 1-like [Populus euphratica] Length = 466 Score = 95.5 bits (236), Expect = 2e-20 Identities = 44/52 (84%), Positives = 48/52 (92%) Frame = -3 Query: 382 ASITTAKSSEINVLVPGSEPDGDWIEQALPQQYVHVFKDGQFVTTPVSHSGG 227 ASITTAKSSEINVLVPG+EPDGD +E ALPQQ++H FKDGQF TTPVSHSGG Sbjct: 415 ASITTAKSSEINVLVPGAEPDGDLVEHALPQQFIHTFKDGQFETTPVSHSGG 466 >gb|KRH29470.1| hypothetical protein GLYMA_11G118300 [Glycine max] Length = 394 Score = 94.7 bits (234), Expect = 2e-20 Identities = 40/53 (75%), Positives = 49/53 (92%) Frame = -3 Query: 385 EASITTAKSSEINVLVPGSEPDGDWIEQALPQQYVHVFKDGQFVTTPVSHSGG 227 EASITTAKSSEINV+VPG++PDGDW+E +LPQQY+H+FK+G F TTP +HSGG Sbjct: 342 EASITTAKSSEINVMVPGADPDGDWVEHSLPQQYIHLFKNGHFETTPAAHSGG 394 >ref|XP_002306100.1| cyclase associated protein 1 [Populus trichocarpa] gb|PNT41398.1| hypothetical protein POPTR_004G153900v3 [Populus trichocarpa] Length = 466 Score = 95.1 bits (235), Expect = 3e-20 Identities = 43/52 (82%), Positives = 48/52 (92%) Frame = -3 Query: 382 ASITTAKSSEINVLVPGSEPDGDWIEQALPQQYVHVFKDGQFVTTPVSHSGG 227 ASITTAKSSEIN+LVPG+EPDGD +E ALPQQ++H FKDGQF TTPVSHSGG Sbjct: 415 ASITTAKSSEINILVPGAEPDGDLVEHALPQQFIHTFKDGQFETTPVSHSGG 466