BLASTX nr result
ID: Rehmannia32_contig00020986
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00020986 (437 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022881599.1| probable anion transporter 5 [Olea europaea ... 60 1e-07 ref|XP_011081516.1| probable anion transporter 5 [Sesamum indicu... 59 2e-07 ref|XP_012857888.1| PREDICTED: probable anion transporter 5 [Ery... 59 3e-07 ref|XP_022845184.1| probable anion transporter 5 [Olea europaea ... 58 5e-07 ref|XP_012843450.1| PREDICTED: probable anion transporter 6 [Ery... 55 6e-06 ref|XP_023766228.1| probable anion transporter 5 [Lactuca sativa... 55 6e-06 >ref|XP_022881599.1| probable anion transporter 5 [Olea europaea var. sylvestris] ref|XP_022881600.1| probable anion transporter 5 [Olea europaea var. sylvestris] ref|XP_022881601.1| probable anion transporter 5 [Olea europaea var. sylvestris] ref|XP_022881602.1| probable anion transporter 5 [Olea europaea var. sylvestris] ref|XP_022881603.1| probable anion transporter 5 [Olea europaea var. sylvestris] ref|XP_022881604.1| probable anion transporter 5 [Olea europaea var. sylvestris] Length = 447 Score = 60.1 bits (144), Expect = 1e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +2 Query: 338 NQRRMKMTYIPKRYVIVILTFICTCVCYIERVG 436 N +RMK T IPKRYVIVILTFICT VCYIERVG Sbjct: 2 NPKRMKRTNIPKRYVIVILTFICTSVCYIERVG 34 >ref|XP_011081516.1| probable anion transporter 5 [Sesamum indicum] ref|XP_011081517.1| probable anion transporter 5 [Sesamum indicum] ref|XP_020550802.1| probable anion transporter 5 [Sesamum indicum] Length = 442 Score = 59.3 bits (142), Expect = 2e-07 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +2 Query: 350 MKMTYIPKRYVIVILTFICTCVCYIERVG 436 M++TY PKRY IVILTFICTCVCYIERVG Sbjct: 1 MRITYFPKRYAIVILTFICTCVCYIERVG 29 >ref|XP_012857888.1| PREDICTED: probable anion transporter 5 [Erythranthe guttata] gb|EYU20236.1| hypothetical protein MIMGU_mgv1a006426mg [Erythranthe guttata] gb|EYU20237.1| hypothetical protein MIMGU_mgv1a006426mg [Erythranthe guttata] Length = 444 Score = 58.9 bits (141), Expect = 3e-07 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +2 Query: 350 MKMTYIPKRYVIVILTFICTCVCYIERVG 436 MK+T +PKRY+IV+LTFICTCVCYIERVG Sbjct: 1 MKITNVPKRYIIVVLTFICTCVCYIERVG 29 >ref|XP_022845184.1| probable anion transporter 5 [Olea europaea var. sylvestris] Length = 445 Score = 58.2 bits (139), Expect = 5e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +2 Query: 344 RRMKMTYIPKRYVIVILTFICTCVCYIERVG 436 +RMK T IPKRYVIVILTFICT VCYIERVG Sbjct: 2 KRMKRTNIPKRYVIVILTFICTSVCYIERVG 32 >ref|XP_012843450.1| PREDICTED: probable anion transporter 6 [Erythranthe guttata] gb|EYU32361.1| hypothetical protein MIMGU_mgv1a024637mg [Erythranthe guttata] Length = 427 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = +2 Query: 350 MKMTYIPKRYVIVILTFICTCVCYIERVG 436 MK +PKRYVIV+LTFICTCVCYIERVG Sbjct: 1 MKSISLPKRYVIVMLTFICTCVCYIERVG 29 >ref|XP_023766228.1| probable anion transporter 5 [Lactuca sativa] gb|PLY83757.1| hypothetical protein LSAT_4X30520 [Lactuca sativa] Length = 438 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = +2 Query: 350 MKMTYIPKRYVIVILTFICTCVCYIERVG 436 M +T IP RYVIVILTF+CTCVCYIERVG Sbjct: 1 MSITRIPSRYVIVILTFMCTCVCYIERVG 29