BLASTX nr result
ID: Rehmannia32_contig00020848
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00020848 (368 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022847875.1| ganglioside-induced differentiation-associat... 55 2e-06 >ref|XP_022847875.1| ganglioside-induced differentiation-associated protein 2 [Olea europaea var. sylvestris] Length = 254 Score = 55.1 bits (131), Expect = 2e-06 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 5/49 (10%) Frame = +3 Query: 222 KSIILHTVLTEMPEGSFHI--LHSFVQKESNSPGLTM---TYEKLPNET 353 K + H +LTEMPEGSF + +HS VQKE NSPGLT+ YE+LPN++ Sbjct: 98 KKYVSHKILTEMPEGSFCVVYMHSTVQKEDNSPGLTILRWIYEELPNDS 146