BLASTX nr result
ID: Rehmannia32_contig00020542
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00020542 (439 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012855903.1| PREDICTED: probable boron transporter 7 [Ery... 96 4e-20 gb|PIN13561.1| hypothetical protein CDL12_13816 [Handroanthus im... 91 2e-18 gb|PIN00052.1| hypothetical protein CDL12_27449 [Handroanthus im... 89 2e-18 ref|XP_011081918.1| boron transporter 4-like [Sesamum indicum] >... 85 3e-16 gb|KZV20722.1| putative boron transporter 7-like [Dorcoceras hyg... 75 9e-13 gb|PIN18410.1| hypothetical protein CDL12_08910 [Handroanthus im... 74 2e-12 ref|XP_022849738.1| probable boron transporter 6 isoform X2 [Ole... 70 5e-11 ref|XP_022849737.1| probable boron transporter 6 isoform X1 [Ole... 70 5e-11 ref|XP_022862276.1| probable boron transporter 7 [Olea europaea ... 68 2e-10 ref|XP_011085892.1| boron transporter 4 [Sesamum indicum] >gi|74... 63 1e-08 ref|XP_003603439.2| boron transporter-like protein [Medicago tru... 63 1e-08 gb|EOY31427.1| HCO3- transporter family [Theobroma cacao] 60 9e-08 ref|XP_007013808.2| PREDICTED: probable boron transporter 7 [The... 60 2e-07 ref|XP_004501300.1| PREDICTED: probable boron transporter 7 [Cic... 60 2e-07 ref|XP_019250777.1| PREDICTED: probable boron transporter 7 [Nic... 59 3e-07 ref|XP_016502731.1| PREDICTED: probable boron transporter 7 [Nic... 59 3e-07 ref|XP_009799564.1| PREDICTED: probable boron transporter 7 [Nic... 59 3e-07 ref|XP_009621374.1| PREDICTED: probable boron transporter 7 [Nic... 59 3e-07 ref|XP_019189931.1| PREDICTED: probable boron transporter 7 [Ipo... 59 3e-07 ref|XP_011085180.1| boron transporter 4-like [Sesamum indicum] 59 3e-07 >ref|XP_012855903.1| PREDICTED: probable boron transporter 7 [Erythranthe guttata] gb|EYU21945.1| hypothetical protein MIMGU_mgv1a002503mg [Erythranthe guttata] Length = 666 Score = 95.9 bits (237), Expect = 4e-20 Identities = 49/60 (81%), Positives = 53/60 (88%) Frame = +1 Query: 1 LSLTDREPPDNDGDEGAPDVSSAEILDEMTTRRGELKHRSVSFNDRQLQSQVVPGGSAGV 180 LSLTDRE PD +GDE +PDVSSAEILDEMTTRRGELKHRSVSFNDRQLQ+ +P G AGV Sbjct: 609 LSLTDRELPDTNGDEASPDVSSAEILDEMTTRRGELKHRSVSFNDRQLQA--IPEGPAGV 666 >gb|PIN13561.1| hypothetical protein CDL12_13816 [Handroanthus impetiginosus] Length = 663 Score = 91.3 bits (225), Expect = 2e-18 Identities = 47/60 (78%), Positives = 52/60 (86%) Frame = +1 Query: 1 LSLTDREPPDNDGDEGAPDVSSAEILDEMTTRRGELKHRSVSFNDRQLQSQVVPGGSAGV 180 LSL DR+PP DGDEG+PDV+SAEILDEMTTRRGELKHRSVSFNDRQLQ++ SAGV Sbjct: 606 LSLRDRDPPCTDGDEGSPDVTSAEILDEMTTRRGELKHRSVSFNDRQLQAK--SEDSAGV 663 >gb|PIN00052.1| hypothetical protein CDL12_27449 [Handroanthus impetiginosus] Length = 303 Score = 89.4 bits (220), Expect = 2e-18 Identities = 46/60 (76%), Positives = 51/60 (85%) Frame = +1 Query: 1 LSLTDREPPDNDGDEGAPDVSSAEILDEMTTRRGELKHRSVSFNDRQLQSQVVPGGSAGV 180 LSL DR+PP DGDEG+PDV+SAEILDEMTT RGELKHRSVSFNDRQLQ++ SAGV Sbjct: 246 LSLRDRDPPCTDGDEGSPDVTSAEILDEMTTHRGELKHRSVSFNDRQLQAK--SEDSAGV 303 >ref|XP_011081918.1| boron transporter 4-like [Sesamum indicum] ref|XP_011081919.1| boron transporter 4-like [Sesamum indicum] ref|XP_011081922.1| boron transporter 4-like [Sesamum indicum] ref|XP_011081923.1| boron transporter 4-like [Sesamum indicum] ref|XP_020549950.1| boron transporter 4-like [Sesamum indicum] ref|XP_020549951.1| boron transporter 4-like [Sesamum indicum] Length = 662 Score = 84.7 bits (208), Expect = 3e-16 Identities = 48/60 (80%), Positives = 50/60 (83%) Frame = +1 Query: 1 LSLTDREPPDNDGDEGAPDVSSAEILDEMTTRRGELKHRSVSFNDRQLQSQVVPGGSAGV 180 LSL DRE PD+D DEGA DVSSAEILDEMTT RGELKHRSVSFNDRQL QV+P SA V Sbjct: 606 LSLKDRELPDSDDDEGA-DVSSAEILDEMTTHRGELKHRSVSFNDRQL--QVIPEDSARV 662 >gb|KZV20722.1| putative boron transporter 7-like [Dorcoceras hygrometricum] Length = 683 Score = 74.7 bits (182), Expect = 9e-13 Identities = 38/50 (76%), Positives = 41/50 (82%), Gaps = 1/50 (2%) Frame = +1 Query: 1 LSLTDREPPDNDGDEG-APDVSSAEILDEMTTRRGELKHRSVSFNDRQLQ 147 LSL DR+ PD D +E PD+SSAEILDEMTT RGELKHRSVSFNDRQ Q Sbjct: 607 LSLRDRQSPDTDEEEDDCPDLSSAEILDEMTTHRGELKHRSVSFNDRQFQ 656 >gb|PIN18410.1| hypothetical protein CDL12_08910 [Handroanthus impetiginosus] Length = 665 Score = 73.9 bits (180), Expect = 2e-12 Identities = 37/53 (69%), Positives = 42/53 (79%) Frame = +1 Query: 22 PPDNDGDEGAPDVSSAEILDEMTTRRGELKHRSVSFNDRQLQSQVVPGGSAGV 180 P D D +E +PDVSSAEILDEMTT RGELKHRS+SFN+RQ QV P GSA + Sbjct: 615 PDDGDDEESSPDVSSAEILDEMTTHRGELKHRSMSFNERQF--QVFPDGSAEI 665 >ref|XP_022849738.1| probable boron transporter 6 isoform X2 [Olea europaea var. sylvestris] ref|XP_022849740.1| probable boron transporter 6 isoform X2 [Olea europaea var. sylvestris] Length = 664 Score = 69.7 bits (169), Expect = 5e-11 Identities = 36/56 (64%), Positives = 44/56 (78%) Frame = +1 Query: 1 LSLTDREPPDNDGDEGAPDVSSAEILDEMTTRRGELKHRSVSFNDRQLQSQVVPGG 168 LSL +RE D DG++ D+SS E+LDEMTTRRGELK+RSVSFN+RQ+ QV P G Sbjct: 607 LSLRNRESADPDGEDDTYDISSDELLDEMTTRRGELKYRSVSFNERQI--QVFPQG 660 >ref|XP_022849737.1| probable boron transporter 6 isoform X1 [Olea europaea var. sylvestris] Length = 675 Score = 69.7 bits (169), Expect = 5e-11 Identities = 36/56 (64%), Positives = 44/56 (78%) Frame = +1 Query: 1 LSLTDREPPDNDGDEGAPDVSSAEILDEMTTRRGELKHRSVSFNDRQLQSQVVPGG 168 LSL +RE D DG++ D+SS E+LDEMTTRRGELK+RSVSFN+RQ+ QV P G Sbjct: 618 LSLRNRESADPDGEDDTYDISSDELLDEMTTRRGELKYRSVSFNERQI--QVFPQG 671 >ref|XP_022862276.1| probable boron transporter 7 [Olea europaea var. sylvestris] ref|XP_022862277.1| probable boron transporter 7 [Olea europaea var. sylvestris] Length = 662 Score = 67.8 bits (164), Expect = 2e-10 Identities = 40/59 (67%), Positives = 41/59 (69%) Frame = +1 Query: 4 SLTDREPPDNDGDEGAPDVSSAEILDEMTTRRGELKHRSVSFNDRQLQSQVVPGGSAGV 180 SL DRE D D +EG DV EILDEMTT RGELKHRSVSF DRQ QV P GS GV Sbjct: 608 SLGDREATDPDDEEG--DVDVYEILDEMTTHRGELKHRSVSFTDRQF--QVFPEGSDGV 662 >ref|XP_011085892.1| boron transporter 4 [Sesamum indicum] ref|XP_011085938.1| boron transporter 4 [Sesamum indicum] ref|XP_011086102.1| boron transporter 4 [Sesamum indicum] ref|XP_020552449.1| boron transporter 4 [Sesamum indicum] ref|XP_020552453.1| boron transporter 4 [Sesamum indicum] Length = 663 Score = 63.2 bits (152), Expect = 1e-08 Identities = 33/59 (55%), Positives = 40/59 (67%) Frame = +1 Query: 4 SLTDREPPDNDGDEGAPDVSSAEILDEMTTRRGELKHRSVSFNDRQLQSQVVPGGSAGV 180 S D E PD+D E + + + AEILDEMTT RGELKHRS+S DRQ V+P GSA + Sbjct: 607 SKRDGESPDDDSGESSDEFTDAEILDEMTTHRGELKHRSMSSRDRQF--PVIPEGSAAM 663 >ref|XP_003603439.2| boron transporter-like protein [Medicago truncatula] gb|AES73690.2| boron transporter-like protein [Medicago truncatula] Length = 678 Score = 63.2 bits (152), Expect = 1e-08 Identities = 31/46 (67%), Positives = 35/46 (76%) Frame = +1 Query: 1 LSLTDREPPDNDGDEGAPDVSSAEILDEMTTRRGELKHRSVSFNDR 138 +SL DREP D+D D + D AEILDEMTT RGELK R+VSFNDR Sbjct: 603 MSLRDREPRDSDNDGSSEDYYDAEILDEMTTNRGELKLRTVSFNDR 648 >gb|EOY31427.1| HCO3- transporter family [Theobroma cacao] Length = 666 Score = 60.5 bits (145), Expect = 9e-08 Identities = 33/58 (56%), Positives = 40/58 (68%) Frame = +1 Query: 1 LSLTDREPPDNDGDEGAPDVSSAEILDEMTTRRGELKHRSVSFNDRQLQSQVVPGGSA 174 +SL +REPPD+ + D AEILDEMTT RGELK R+VSF + +L QV P GSA Sbjct: 610 ISLKEREPPDSSSEGTDDDFYDAEILDEMTTNRGELKLRTVSFKEERLH-QVHPEGSA 666 >ref|XP_007013808.2| PREDICTED: probable boron transporter 7 [Theobroma cacao] Length = 666 Score = 59.7 bits (143), Expect = 2e-07 Identities = 33/58 (56%), Positives = 39/58 (67%) Frame = +1 Query: 1 LSLTDREPPDNDGDEGAPDVSSAEILDEMTTRRGELKHRSVSFNDRQLQSQVVPGGSA 174 +SL +REPPD+ D AEILDEMTT RGELK R+VSF + +L QV P GSA Sbjct: 610 ISLKEREPPDSSSQGTDDDFYDAEILDEMTTNRGELKLRTVSFKEERLH-QVHPEGSA 666 >ref|XP_004501300.1| PREDICTED: probable boron transporter 7 [Cicer arietinum] Length = 668 Score = 59.7 bits (143), Expect = 2e-07 Identities = 29/46 (63%), Positives = 34/46 (73%) Frame = +1 Query: 1 LSLTDREPPDNDGDEGAPDVSSAEILDEMTTRRGELKHRSVSFNDR 138 +S D+EP D+D D + D AEILDEMTT RGELK R+VSFNDR Sbjct: 603 MSFKDKEPHDSDTDGSSEDYYDAEILDEMTTNRGELKLRTVSFNDR 648 >ref|XP_019250777.1| PREDICTED: probable boron transporter 7 [Nicotiana attenuata] gb|OIT08428.1| putative boron transporter 7 [Nicotiana attenuata] Length = 655 Score = 58.9 bits (141), Expect = 3e-07 Identities = 33/56 (58%), Positives = 39/56 (69%) Frame = +1 Query: 13 DREPPDNDGDEGAPDVSSAEILDEMTTRRGELKHRSVSFNDRQLQSQVVPGGSAGV 180 +RE PD + D D S AEILDEMTT RGELKHRSVSF +R Q QV P ++G+ Sbjct: 606 EREIPDEEND----DFSDAEILDEMTTHRGELKHRSVSFTER--QHQVYPHEASGM 655 >ref|XP_016502731.1| PREDICTED: probable boron transporter 7 [Nicotiana tabacum] ref|XP_016502736.1| PREDICTED: probable boron transporter 7 [Nicotiana tabacum] Length = 655 Score = 58.9 bits (141), Expect = 3e-07 Identities = 33/56 (58%), Positives = 39/56 (69%) Frame = +1 Query: 13 DREPPDNDGDEGAPDVSSAEILDEMTTRRGELKHRSVSFNDRQLQSQVVPGGSAGV 180 +RE PD + D D S AEILDEMTT RGELKHRSVSF +R Q QV P ++G+ Sbjct: 606 EREIPDEEND----DFSDAEILDEMTTHRGELKHRSVSFTER--QHQVYPHEASGM 655 >ref|XP_009799564.1| PREDICTED: probable boron transporter 7 [Nicotiana sylvestris] ref|XP_016495710.1| PREDICTED: probable boron transporter 7 [Nicotiana tabacum] Length = 655 Score = 58.9 bits (141), Expect = 3e-07 Identities = 33/56 (58%), Positives = 39/56 (69%) Frame = +1 Query: 13 DREPPDNDGDEGAPDVSSAEILDEMTTRRGELKHRSVSFNDRQLQSQVVPGGSAGV 180 +RE PD + D D S AEILDEMTT RGELKHRSVSF +R Q QV P ++G+ Sbjct: 606 EREIPDEESD----DFSDAEILDEMTTHRGELKHRSVSFTER--QHQVYPHEASGM 655 >ref|XP_009621374.1| PREDICTED: probable boron transporter 7 [Nicotiana tomentosiformis] ref|XP_009621375.1| PREDICTED: probable boron transporter 7 [Nicotiana tomentosiformis] Length = 655 Score = 58.9 bits (141), Expect = 3e-07 Identities = 33/56 (58%), Positives = 39/56 (69%) Frame = +1 Query: 13 DREPPDNDGDEGAPDVSSAEILDEMTTRRGELKHRSVSFNDRQLQSQVVPGGSAGV 180 +RE PD + D D S AEILDEMTT RGELKHRSVSF +R Q QV P ++G+ Sbjct: 606 EREIPDEEND----DFSDAEILDEMTTHRGELKHRSVSFTER--QHQVYPHEASGM 655 >ref|XP_019189931.1| PREDICTED: probable boron transporter 7 [Ipomoea nil] Length = 659 Score = 58.9 bits (141), Expect = 3e-07 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = +1 Query: 13 DREPPDNDGDEGAPDVSSAEILDEMTTRRGELKHRSVSFNDR 138 +R+ P +GD+ D +SAEILDEMTTRRGELKHRS S N+R Sbjct: 607 ERDTPPKEGDDEDDDYTSAEILDEMTTRRGELKHRSTSVNER 648 >ref|XP_011085180.1| boron transporter 4-like [Sesamum indicum] Length = 665 Score = 58.9 bits (141), Expect = 3e-07 Identities = 28/53 (52%), Positives = 36/53 (67%) Frame = +1 Query: 4 SLTDREPPDNDGDEGAPDVSSAEILDEMTTRRGELKHRSVSFNDRQLQSQVVP 162 S D E PD+D E + + + AEILDEMTT RGELKHRS++ DR Q ++P Sbjct: 607 SKRDGESPDDDSGESSDEFTDAEILDEMTTHRGELKHRSMNSRDRLSQKDLLP 659