BLASTX nr result
ID: Rehmannia32_contig00019899
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00019899 (382 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN11201.1| hypothetical protein CDL12_16202 [Handroanthus im... 82 3e-18 gb|PIN11951.1| hypothetical protein CDL12_15416 [Handroanthus im... 75 1e-15 ref|XP_014629336.1| PREDICTED: uncharacterized protein LOC106798... 50 6e-06 ref|XP_016671151.1| PREDICTED: uncharacterized protein LOC107891... 50 9e-06 ref|XP_008387738.1| PREDICTED: uncharacterized protein LOC103450... 50 9e-06 >gb|PIN11201.1| hypothetical protein CDL12_16202 [Handroanthus impetiginosus] Length = 43 Score = 81.6 bits (200), Expect = 3e-18 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = -2 Query: 150 MHSVPSSDFLLLTRPHVTSFYGGSSFHRLKHLHKSDRRGNLSN 22 MHSVPS+D LLLTR HVTSFYGGSSFHRLKHL KSDRRGNLS+ Sbjct: 1 MHSVPSNDLLLLTRQHVTSFYGGSSFHRLKHLQKSDRRGNLSS 43 >gb|PIN11951.1| hypothetical protein CDL12_15416 [Handroanthus impetiginosus] gb|PIN15072.1| hypothetical protein CDL12_12303 [Handroanthus impetiginosus] Length = 43 Score = 74.7 bits (182), Expect = 1e-15 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = -2 Query: 150 MHSVPSSDFLLLTRPHVTSFYGGSSFHRLKHLHKSDRRGNLSN 22 MHSVPS D ++ TRPH+TSFYGGSS HRLKHL KSDRRGN+S+ Sbjct: 1 MHSVPSYDLVVFTRPHLTSFYGGSSSHRLKHLQKSDRRGNISS 43 >ref|XP_014629336.1| PREDICTED: uncharacterized protein LOC106798098 [Glycine max] Length = 39 Score = 50.1 bits (118), Expect = 6e-06 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = -2 Query: 141 VPSSDFLLLTRPHVTSFYGGSSFHRLKHLHKSDRRGNLS 25 +PS L P +T F+GGSSFHRLK+L KSDRRGNLS Sbjct: 1 MPSVPVDLRLVPSLTVFHGGSSFHRLKNLEKSDRRGNLS 39 >ref|XP_016671151.1| PREDICTED: uncharacterized protein LOC107891031 [Gossypium hirsutum] gb|KJB36758.1| hypothetical protein B456_006G175300 [Gossypium raimondii] Length = 42 Score = 49.7 bits (117), Expect = 9e-06 Identities = 25/42 (59%), Positives = 28/42 (66%) Frame = -2 Query: 150 MHSVPSSDFLLLTRPHVTSFYGGSSFHRLKHLHKSDRRGNLS 25 M S+P LL P +T F+ G S HRLKHL KSDRRGNLS Sbjct: 1 MPSLPLRSILLPLIPSLTPFHAGLSSHRLKHLEKSDRRGNLS 42 >ref|XP_008387738.1| PREDICTED: uncharacterized protein LOC103450204 isoform X2 [Malus domestica] Length = 42 Score = 49.7 bits (117), Expect = 9e-06 Identities = 25/42 (59%), Positives = 30/42 (71%) Frame = -2 Query: 150 MHSVPSSDFLLLTRPHVTSFYGGSSFHRLKHLHKSDRRGNLS 25 M SVP+ L + P++TSF+GGS HRLK L K DRRGNLS Sbjct: 1 MPSVPTHLLLRPSVPNLTSFHGGSCSHRLKRLEKGDRRGNLS 42