BLASTX nr result
ID: Rehmannia32_contig00019863
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00019863 (371 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKX88298.1| hypothetical protein P174DRAFT_380638 [Aspergillu... 104 1e-39 gb|PKX88264.1| hypothetical protein P174DRAFT_479418 [Aspergillu... 116 8e-31 dbj|GAO47202.1| hypothetical protein G7K_1412-t1 [Saitoella comp... 114 2e-29 ref|XP_018060498.1| hypothetical protein LY89DRAFT_703091 [Phial... 101 1e-25 emb|SMQ52684.1| unnamed protein product [Zymoseptoria tritici ST... 89 8e-21 gb|PKX88176.1| hypothetical protein P174DRAFT_380988, partial [A... 87 2e-20 gb|PLB42937.1| hypothetical protein P170DRAFT_318339, partial [A... 86 1e-19 ref|WP_105937107.1| hypothetical protein [Salmonella enterica] 87 1e-19 gb|OJJ66804.1| hypothetical protein ASPBRDRAFT_366689 [Aspergill... 85 2e-19 gb|PLB42840.1| hypothetical protein P170DRAFT_371392, partial [A... 85 2e-19 gb|PLB42991.1| hypothetical protein P170DRAFT_78608 [Aspergillus... 85 2e-19 gb|PLB42781.1| hypothetical protein P170DRAFT_491262 [Aspergillu... 85 9e-19 emb|CQB88528.1| Uncharacterised protein [Chlamydia trachomatis] 60 1e-18 ref|XP_022576478.1| hypothetical protein ASPZODRAFT_1284245 [Pen... 83 1e-18 gb|KDQ49122.1| hypothetical protein JAAARDRAFT_143838, partial [... 83 2e-18 gb|EGN91453.1| hypothetical protein SERLA73DRAFT_67379, partial ... 82 3e-18 gb|KZP03156.1| hypothetical protein FIBSPDRAFT_505248, partial [... 81 6e-18 gb|PKX99747.1| hypothetical protein P168DRAFT_245600, partial [A... 80 2e-17 gb|OCL10867.1| hypothetical protein AOQ84DRAFT_396602 [Glonium s... 80 3e-17 gb|KNA06142.1| hypothetical protein SOVF_183600 [Spinacia oleracea] 79 3e-17 >gb|PKX88298.1| hypothetical protein P174DRAFT_380638 [Aspergillus novofumigatus IBT 16806] gb|PKX88308.1| hypothetical protein P174DRAFT_380684 [Aspergillus novofumigatus IBT 16806] Length = 177 Score = 104 bits (260), Expect(2) = 1e-39 Identities = 43/44 (97%), Positives = 43/44 (97%) Frame = +2 Query: 2 IKVVAVKKLVVEPWVWLAGPPHREYWSGWTFPSGESHGLHWLWG 133 IKVVAVKKLVVEPWVWLAGPPHREYWSGWTFPSGE HGLHWLWG Sbjct: 94 IKVVAVKKLVVEPWVWLAGPPHREYWSGWTFPSGEPHGLHWLWG 137 Score = 86.3 bits (212), Expect(2) = 1e-39 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +3 Query: 132 GNQDFYCEKIRVFKAGLCSNTLAWNNRIGRAVLFCWF 242 GNQDFYCEKIRVFKAGLCSNTLAWNNRIGRAVLFCWF Sbjct: 137 GNQDFYCEKIRVFKAGLCSNTLAWNNRIGRAVLFCWF 173 >gb|PKX88264.1| hypothetical protein P174DRAFT_479418 [Aspergillus novofumigatus IBT 16806] gb|PKX88280.1| hypothetical protein P174DRAFT_380726 [Aspergillus novofumigatus IBT 16806] Length = 143 Score = 116 bits (290), Expect = 8e-31 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = +2 Query: 2 IKVVAVKKLVVEPWVWLAGPPHREYWSGWTFPSGESHGLHWLWGEPGLLL 151 IKVVAVKKLVVEPWVWLAGPPHREYWSGWTFPSGE HGLHWLWGEPGLLL Sbjct: 94 IKVVAVKKLVVEPWVWLAGPPHREYWSGWTFPSGEPHGLHWLWGEPGLLL 143 >dbj|GAO47202.1| hypothetical protein G7K_1412-t1 [Saitoella complicata NRRL Y-17804] Length = 214 Score = 114 bits (286), Expect = 2e-29 Identities = 66/113 (58%), Positives = 70/113 (61%), Gaps = 3/113 (2%) Frame = -2 Query: 331 LVFSKSKNFTSDS*ILTPPTIPINHYGGPRNQQNRTARPILLFHANVFEQRPALNTLIFS 152 LV KSKNFTSDS IL PPTIPINHYGGPRNQQNRT RPILLFHANVFEQ PALNTLIFS Sbjct: 61 LVLRKSKNFTSDSAILMPPTIPINHYGGPRNQQNRTTRPILLFHANVFEQMPALNTLIFS 120 Query: 151 Q*KSWFPPQPVKAMRFPRRKGPAGPVLAVRRTGQPDPRFNYEL---FNCNNFN 2 K +P + P P L + R PD N NC + N Sbjct: 121 NQKE----RPGRVSSHREADRPTRPKLELPRLLAPDLPSNCSSLRDLNCTHSN 169 >ref|XP_018060498.1| hypothetical protein LY89DRAFT_703091 [Phialocephala scopiformis] gb|KUJ06143.1| hypothetical protein LY89DRAFT_703091 [Phialocephala scopiformis] Length = 90 Score = 101 bits (251), Expect = 1e-25 Identities = 56/110 (50%), Positives = 58/110 (52%) Frame = -2 Query: 331 LVFSKSKNFTSDS*ILTPPTIPINHYGGPRNQQNRTARPILLFHANVFEQRPALNTLIFS 152 LV +KSKNFTSD+ ILTPPTIPINHYGGPRNQQNRT RPILLFHAN Sbjct: 7 LVLNKSKNFTSDNLILTPPTIPINHYGGPRNQQNRTTRPILLFHAN-------------- 52 Query: 151 Q*KSWFPPQPVKAMRFPRRKGPAGPVLAVRRTGQPDPRFNYELFNCNNFN 2 P PRFNYELFNCNNFN Sbjct: 53 ----------------------------------PGPRFNYELFNCNNFN 68 >emb|SMQ52684.1| unnamed protein product [Zymoseptoria tritici ST99CH_3D7] emb|SMQ52685.1| unnamed protein product [Zymoseptoria tritici ST99CH_3D7] Length = 82 Score = 89.0 bits (219), Expect = 8e-21 Identities = 47/93 (50%), Positives = 51/93 (54%) Frame = -2 Query: 280 PPTIPINHYGGPRNQQNRTARPILLFHANVFEQRPALNTLIFSQ*KSWFPPQPVKAMRFP 101 PPTIPINHYGGPRNQQNRT RPILLFHAN SWFP P + P Sbjct: 2 PPTIPINHYGGPRNQQNRTTRPILLFHAN-----------------SWFPDTPSEGHAAP 44 Query: 100 RRKGPAGPVLAVRRTGQPDPRFNYELFNCNNFN 2 +++ RFNYELFNCNNFN Sbjct: 45 QKE-----------------RFNYELFNCNNFN 60 >gb|PKX88176.1| hypothetical protein P174DRAFT_380988, partial [Aspergillus novofumigatus IBT 16806] gb|PKX88238.1| hypothetical protein P174DRAFT_380919, partial [Aspergillus novofumigatus IBT 16806] gb|PKX89134.1| hypothetical protein P174DRAFT_379364, partial [Aspergillus novofumigatus IBT 16806] gb|PKX93496.1| hypothetical protein P174DRAFT_372206, partial [Aspergillus novofumigatus IBT 16806] gb|PKX93506.1| hypothetical protein P174DRAFT_371845, partial [Aspergillus novofumigatus IBT 16806] gb|PKX99715.1| hypothetical protein P168DRAFT_245651, partial [Aspergillus campestris IBT 28561] gb|PKX99737.1| hypothetical protein P168DRAFT_245596, partial [Aspergillus campestris IBT 28561] gb|PKX99761.1| hypothetical protein P168DRAFT_245505, partial [Aspergillus campestris IBT 28561] gb|PKX99786.1| hypothetical protein P168DRAFT_245472, partial [Aspergillus campestris IBT 28561] gb|PKX99794.1| hypothetical protein P168DRAFT_245447, partial [Aspergillus campestris IBT 28561] gb|PKX99801.1| hypothetical protein P168DRAFT_245390, partial [Aspergillus campestris IBT 28561] gb|PKX99810.1| hypothetical protein P168DRAFT_245350, partial [Aspergillus campestris IBT 28561] gb|PKX99821.1| hypothetical protein P168DRAFT_245369, partial [Aspergillus campestris IBT 28561] gb|PKX99830.1| hypothetical protein P168DRAFT_245347, partial [Aspergillus campestris IBT 28561] gb|PKY04581.1| hypothetical protein P168DRAFT_236091, partial [Aspergillus campestris IBT 28561] gb|PLB42745.1| hypothetical protein P170DRAFT_371641, partial [Aspergillus steynii IBT 23096] gb|PLB42770.1| hypothetical protein P170DRAFT_371577, partial [Aspergillus steynii IBT 23096] gb|PLB42780.1| hypothetical protein P170DRAFT_371547, partial [Aspergillus steynii IBT 23096] gb|PLB42796.1| hypothetical protein P170DRAFT_371518, partial [Aspergillus steynii IBT 23096] gb|PLB42797.1| hypothetical protein P170DRAFT_371467, partial [Aspergillus steynii IBT 23096] gb|PLB42803.1| hypothetical protein P170DRAFT_371478, partial [Aspergillus steynii IBT 23096] gb|PLB42804.1| hypothetical protein P170DRAFT_371441, partial [Aspergillus steynii IBT 23096] gb|PLB42813.1| hypothetical protein P170DRAFT_371414, partial [Aspergillus steynii IBT 23096] gb|PLB42847.1| hypothetical protein P170DRAFT_371284, partial [Aspergillus steynii IBT 23096] gb|PLB42874.1| hypothetical protein P170DRAFT_371218, partial [Aspergillus steynii IBT 23096] gb|PLB42882.1| hypothetical protein P170DRAFT_371201, partial [Aspergillus steynii IBT 23096] gb|PLB42903.1| hypothetical protein P170DRAFT_371082, partial [Aspergillus steynii IBT 23096] gb|PLB42928.1| hypothetical protein P170DRAFT_371049, partial [Aspergillus steynii IBT 23096] gb|PLB42938.1| hypothetical protein P170DRAFT_370989, partial [Aspergillus steynii IBT 23096] gb|PLB42947.1| hypothetical protein P170DRAFT_371001, partial [Aspergillus steynii IBT 23096] gb|PLB42958.1| hypothetical protein P170DRAFT_370959, partial [Aspergillus steynii IBT 23096] gb|PLB42971.1| hypothetical protein P170DRAFT_370924, partial [Aspergillus steynii IBT 23096] gb|PLB42981.1| hypothetical protein P170DRAFT_370885, partial [Aspergillus steynii IBT 23096] gb|PLB42992.1| hypothetical protein P170DRAFT_370801, partial [Aspergillus steynii IBT 23096] gb|PLB43001.1| hypothetical protein P170DRAFT_370765, partial [Aspergillus steynii IBT 23096] gb|PLB43012.1| hypothetical protein P170DRAFT_370854, partial [Aspergillus steynii IBT 23096] gb|PLB43023.1| hypothetical protein P170DRAFT_370757, partial [Aspergillus steynii IBT 23096] gb|PLB43033.1| hypothetical protein P170DRAFT_370746, partial [Aspergillus steynii IBT 23096] gb|PLB43044.1| hypothetical protein P170DRAFT_370719, partial [Aspergillus steynii IBT 23096] gb|PLB43062.1| hypothetical protein P170DRAFT_370612, partial [Aspergillus steynii IBT 23096] gb|PLB43074.1| hypothetical protein P170DRAFT_370579, partial [Aspergillus steynii IBT 23096] Length = 70 Score = 87.4 bits (215), Expect = 2e-20 Identities = 48/96 (50%), Positives = 48/96 (50%) Frame = -2 Query: 289 ILTPPTIPINHYGGPRNQQNRTARPILLFHANVFEQRPALNTLIFSQ*KSWFPPQPVKAM 110 ILTPPTIPINHYGGPRNQQNRTARPILLFHAN Sbjct: 1 ILTPPTIPINHYGGPRNQQNRTARPILLFHAN---------------------------- 32 Query: 109 RFPRRKGPAGPVLAVRRTGQPDPRFNYELFNCNNFN 2 PDPRFNYELFNCNNFN Sbjct: 33 --------------------PDPRFNYELFNCNNFN 48 >gb|PLB42937.1| hypothetical protein P170DRAFT_318339, partial [Aspergillus steynii IBT 23096] Length = 69 Score = 85.9 bits (211), Expect = 1e-19 Identities = 47/95 (49%), Positives = 47/95 (49%) Frame = -2 Query: 286 LTPPTIPINHYGGPRNQQNRTARPILLFHANVFEQRPALNTLIFSQ*KSWFPPQPVKAMR 107 LTPPTIPINHYGGPRNQQNRTARPILLFHAN Sbjct: 1 LTPPTIPINHYGGPRNQQNRTARPILLFHAN----------------------------- 31 Query: 106 FPRRKGPAGPVLAVRRTGQPDPRFNYELFNCNNFN 2 PDPRFNYELFNCNNFN Sbjct: 32 -------------------PDPRFNYELFNCNNFN 47 >ref|WP_105937107.1| hypothetical protein [Salmonella enterica] Length = 98 Score = 86.7 bits (213), Expect = 1e-19 Identities = 41/54 (75%), Positives = 44/54 (81%), Gaps = 1/54 (1%) Frame = +3 Query: 84 AGPFLLGNLMAFTGCG-GNQDFYCEKIRVFKAGLCSNTLAWNNRIGRAVLFCWF 242 AGP+LL + A C GNQDFY EKIRVFKAGLC NTLAWNN+IGRAVLFCWF Sbjct: 41 AGPYLLVSRRALYWCALGNQDFYLEKIRVFKAGLCLNTLAWNNKIGRAVLFCWF 94 >gb|OJJ66804.1| hypothetical protein ASPBRDRAFT_366689 [Aspergillus brasiliensis CBS 101740] gb|PKX88230.1| hypothetical protein P174DRAFT_380900 [Aspergillus novofumigatus IBT 16806] gb|PKX88271.1| hypothetical protein P174DRAFT_380764 [Aspergillus novofumigatus IBT 16806] gb|PLB42889.1| hypothetical protein P170DRAFT_371182 [Aspergillus steynii IBT 23096] gb|PLB42918.1| hypothetical protein P170DRAFT_451513 [Aspergillus steynii IBT 23096] Length = 59 Score = 84.7 bits (208), Expect = 2e-19 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 112 MRFPRRKGPAGPVLAVRRTGQPDPRFNYELFNCNNFN 2 MRFPRRKGPAGPVLAVRRTGQPDPRFNYELFNCNNFN Sbjct: 1 MRFPRRKGPAGPVLAVRRTGQPDPRFNYELFNCNNFN 37 >gb|PLB42840.1| hypothetical protein P170DRAFT_371392, partial [Aspergillus steynii IBT 23096] Length = 74 Score = 85.1 bits (209), Expect = 2e-19 Identities = 49/96 (51%), Positives = 49/96 (51%) Frame = -2 Query: 289 ILTPPTIPINHYGGPRNQQNRTARPILLFHANVFEQRPALNTLIFSQ*KSWFPPQPVKAM 110 ILTPPTIPINHYGGPRNQQNRTARPILLFHAN RPA Sbjct: 1 ILTPPTIPINHYGGPRNQQNRTARPILLFHANA--DRPA--------------------- 37 Query: 109 RFPRRKGPAGPVLAVRRTGQPDPRFNYELFNCNNFN 2 PRFNYELFNCNNFN Sbjct: 38 ---------------------RPRFNYELFNCNNFN 52 >gb|PLB42991.1| hypothetical protein P170DRAFT_78608 [Aspergillus steynii IBT 23096] Length = 64 Score = 84.7 bits (208), Expect = 2e-19 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 112 MRFPRRKGPAGPVLAVRRTGQPDPRFNYELFNCNNFN 2 MRFPRRKGPAGPVLAVRRTGQPDPRFNYELFNCNNFN Sbjct: 1 MRFPRRKGPAGPVLAVRRTGQPDPRFNYELFNCNNFN 37 >gb|PLB42781.1| hypothetical protein P170DRAFT_491262 [Aspergillus steynii IBT 23096] Length = 113 Score = 84.7 bits (208), Expect = 9e-19 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 112 MRFPRRKGPAGPVLAVRRTGQPDPRFNYELFNCNNFN 2 MRFPRRKGPAGPVLAVRRTGQPDPRFNYELFNCNNFN Sbjct: 1 MRFPRRKGPAGPVLAVRRTGQPDPRFNYELFNCNNFN 37 >emb|CQB88528.1| Uncharacterised protein [Chlamydia trachomatis] Length = 67 Score = 60.5 bits (145), Expect(2) = 1e-18 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +3 Query: 135 NQDFYCEKIRVFKAGLCSNTLAWNNRIGR 221 NQDFY EKIRVFKAGLCSN LAWNNRIGR Sbjct: 3 NQDFYFEKIRVFKAGLCSNILAWNNRIGR 31 Score = 60.5 bits (145), Expect(2) = 1e-18 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = +2 Query: 224 GSILLVSRTAVMINRDSRGRQYSAVRGEILGFAED 328 GSILLVSRT VMINRD RG QYS VRGEILGF ED Sbjct: 33 GSILLVSRTIVMINRDGRGYQYSVVRGEILGFTED 67 >ref|XP_022576478.1| hypothetical protein ASPZODRAFT_1284245 [Penicilliopsis zonata CBS 506.65] gb|OJJ41968.1| hypothetical protein ASPZODRAFT_1284245 [Penicilliopsis zonata CBS 506.65] Length = 59 Score = 82.8 bits (203), Expect = 1e-18 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -2 Query: 112 MRFPRRKGPAGPVLAVRRTGQPDPRFNYELFNCNNFN 2 M FPRRKGPAGPVLAVRRTGQPDPRFNYELFNCNNFN Sbjct: 1 MEFPRRKGPAGPVLAVRRTGQPDPRFNYELFNCNNFN 37 >gb|KDQ49122.1| hypothetical protein JAAARDRAFT_143838, partial [Jaapia argillacea MUCL 33604] Length = 80 Score = 82.8 bits (203), Expect = 2e-18 Identities = 49/110 (44%), Positives = 51/110 (46%) Frame = -2 Query: 331 LVFSKSKNFTSDS*ILTPPTIPINHYGGPRNQQNRTARPILLFHANVFEQRPALNTLIFS 152 LVF KSKNFTS + IL PPT+PINHYG RNQQNRTARPILLFHAN Sbjct: 1 LVFGKSKNFTSSNRILMPPTVPINHYGDSRNQQNRTARPILLFHAN-------------- 46 Query: 151 Q*KSWFPPQPVKAMRFPRRKGPAGPVLAVRRTGQPDPRFNYELFNCNNFN 2 FNY LFNCNNFN Sbjct: 47 --------------------------------------FNYGLFNCNNFN 58 >gb|EGN91453.1| hypothetical protein SERLA73DRAFT_67379, partial [Serpula lacrymans var. lacrymans S7.3] Length = 80 Score = 82.4 bits (202), Expect = 3e-18 Identities = 49/110 (44%), Positives = 51/110 (46%) Frame = -2 Query: 331 LVFSKSKNFTSDS*ILTPPTIPINHYGGPRNQQNRTARPILLFHANVFEQRPALNTLIFS 152 LVFSKSKNFTS + IL PT+PINHYG RNQQNRTA PILLFHAN Sbjct: 1 LVFSKSKNFTSSNRILMSPTVPINHYGNSRNQQNRTAHPILLFHAN-------------- 46 Query: 151 Q*KSWFPPQPVKAMRFPRRKGPAGPVLAVRRTGQPDPRFNYELFNCNNFN 2 FNYELFNCNNFN Sbjct: 47 --------------------------------------FNYELFNCNNFN 58 >gb|KZP03156.1| hypothetical protein FIBSPDRAFT_505248, partial [Fibularhizoctonia sp. CBS 109695] Length = 50 Score = 80.9 bits (198), Expect = 6e-18 Identities = 35/40 (87%), Positives = 35/40 (87%) Frame = +3 Query: 123 GCGGNQDFYCEKIRVFKAGLCSNTLAWNNRIGRAVLFCWF 242 G GNQDFY EKIRVFKAGLC NTLAWNN IGRAVLFCWF Sbjct: 7 GASGNQDFYLEKIRVFKAGLCPNTLAWNNEIGRAVLFCWF 46 >gb|PKX99747.1| hypothetical protein P168DRAFT_245600, partial [Aspergillus campestris IBT 28561] gb|PKX99777.1| hypothetical protein P168DRAFT_245433, partial [Aspergillus campestris IBT 28561] gb|PLB42828.1| hypothetical protein P170DRAFT_371383, partial [Aspergillus steynii IBT 23096] gb|PLB42858.1| hypothetical protein P170DRAFT_371258, partial [Aspergillus steynii IBT 23096] gb|PLB42913.1| hypothetical protein P170DRAFT_371091, partial [Aspergillus steynii IBT 23096] gb|PLB45342.1| hypothetical protein P170DRAFT_366700, partial [Aspergillus steynii IBT 23096] Length = 66 Score = 79.7 bits (195), Expect = 2e-17 Identities = 44/92 (47%), Positives = 44/92 (47%) Frame = -2 Query: 277 PTIPINHYGGPRNQQNRTARPILLFHANVFEQRPALNTLIFSQ*KSWFPPQPVKAMRFPR 98 PTIPINHYGGPRNQQNRTARPILLFHAN Sbjct: 1 PTIPINHYGGPRNQQNRTARPILLFHAN-------------------------------- 28 Query: 97 RKGPAGPVLAVRRTGQPDPRFNYELFNCNNFN 2 PDPRFNYELFNCNNFN Sbjct: 29 ----------------PDPRFNYELFNCNNFN 44 >gb|OCL10867.1| hypothetical protein AOQ84DRAFT_396602 [Glonium stellatum] Length = 68 Score = 79.7 bits (195), Expect = 3e-17 Identities = 44/93 (47%), Positives = 44/93 (47%) Frame = -2 Query: 280 PPTIPINHYGGPRNQQNRTARPILLFHANVFEQRPALNTLIFSQ*KSWFPPQPVKAMRFP 101 PPTIPINHYGGPRNQQNRTARPILLFHAN Sbjct: 2 PPTIPINHYGGPRNQQNRTARPILLFHAN------------------------------- 30 Query: 100 RRKGPAGPVLAVRRTGQPDPRFNYELFNCNNFN 2 P PRFNYELFNCNNFN Sbjct: 31 -----------------PGPRFNYELFNCNNFN 46 >gb|KNA06142.1| hypothetical protein SOVF_183600 [Spinacia oleracea] Length = 59 Score = 79.3 bits (194), Expect = 3e-17 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = -2 Query: 112 MRFPRRKGPAGPVLAVRRTGQPDPRFNYELFNCNNFN 2 MRFPRRKGPAGPV AVRRTGQP PRFNYELFNCNNFN Sbjct: 1 MRFPRRKGPAGPVHAVRRTGQPGPRFNYELFNCNNFN 37