BLASTX nr result
ID: Rehmannia32_contig00019813
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00019813 (392 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN09091.1| hypothetical protein CDL12_18328 [Handroanthus im... 82 4e-17 ref|XP_022890030.1| pleckstrin homology domain-containing protei... 79 6e-16 ref|XP_019228405.1| PREDICTED: pleckstrin homology domain-contai... 79 6e-16 ref|XP_022861490.1| pleckstrin homology domain-containing protei... 79 7e-16 ref|XP_012858857.1| PREDICTED: pleckstrin homology domain-contai... 79 7e-16 ref|XP_011076681.1| pleckstrin homology domain-containing protei... 79 7e-16 ref|XP_019192300.1| PREDICTED: pleckstrin homology domain-contai... 79 7e-16 gb|EYU20025.1| hypothetical protein MIMGU_mgv1a014948mg [Erythra... 79 1e-15 gb|EPS69948.1| hypothetical protein M569_04813 [Genlisea aurea] 77 2e-15 ref|XP_016515565.1| PREDICTED: pleckstrin homology domain-contai... 77 4e-15 gb|PIN09683.1| hypothetical protein CDL12_17735 [Handroanthus im... 77 4e-15 gb|PIN01781.1| hypothetical protein CDL12_25707 [Handroanthus im... 77 4e-15 gb|KZV52862.1| Pleckstrin (PH) domain superfamily protein [Dorco... 75 1e-14 ref|XP_009780334.1| PREDICTED: pleckstrin homology domain-contai... 75 1e-14 gb|ONI21348.1| hypothetical protein PRUPE_2G060800 [Prunus persica] 74 2e-14 ref|XP_016471992.1| PREDICTED: pleckstrin homology domain-contai... 75 2e-14 gb|PLY98923.1| hypothetical protein LSAT_7X35761 [Lactuca sativa] 73 2e-14 ref|XP_015877394.1| PREDICTED: pleckstrin homology domain-contai... 74 3e-14 ref|XP_015877317.1| PREDICTED: pleckstrin homology domain-contai... 74 3e-14 ref|XP_023771079.1| pleckstrin homology domain-containing protei... 74 3e-14 >gb|PIN09091.1| hypothetical protein CDL12_18328 [Handroanthus impetiginosus] Length = 147 Score = 81.6 bits (200), Expect = 4e-17 Identities = 40/42 (95%), Positives = 40/42 (95%) Frame = +2 Query: 2 FIADSEKEKEDWINSIGRSIVQQSRSVTDNEILDYDSRKSSG 127 FIADSEKEKEDWINSIGRSIVQ SRSVTD EILDYDSRKSSG Sbjct: 106 FIADSEKEKEDWINSIGRSIVQHSRSVTDGEILDYDSRKSSG 147 >ref|XP_022890030.1| pleckstrin homology domain-containing protein 1-like [Olea europaea var. sylvestris] Length = 143 Score = 78.6 bits (192), Expect = 6e-16 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = +2 Query: 2 FIADSEKEKEDWINSIGRSIVQQSRSVTDNEILDYDSRK 118 FIADSEKEKEDWINSIGRSIVQ SRSVTDNEILDYDSRK Sbjct: 105 FIADSEKEKEDWINSIGRSIVQHSRSVTDNEILDYDSRK 143 >ref|XP_019228405.1| PREDICTED: pleckstrin homology domain-containing protein 1-like [Nicotiana attenuata] gb|OIT06229.1| pleckstrin -likey domain-containing protein 1 [Nicotiana attenuata] Length = 143 Score = 78.6 bits (192), Expect = 6e-16 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +2 Query: 2 FIADSEKEKEDWINSIGRSIVQQSRSVTDNEILDYDSRK 118 FIADSEKEKEDWINSIGRSIVQQSRSVTD+EILDYDSRK Sbjct: 105 FIADSEKEKEDWINSIGRSIVQQSRSVTDDEILDYDSRK 143 >ref|XP_022861490.1| pleckstrin homology domain-containing protein 1-like [Olea europaea var. sylvestris] Length = 144 Score = 78.6 bits (192), Expect = 7e-16 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = +2 Query: 2 FIADSEKEKEDWINSIGRSIVQQSRSVTDNEILDYDSRK 118 FIADSEKEKEDWINSIGRSIVQ SRSVTDNEILDYDSRK Sbjct: 105 FIADSEKEKEDWINSIGRSIVQHSRSVTDNEILDYDSRK 143 >ref|XP_012858857.1| PREDICTED: pleckstrin homology domain-containing protein 1 [Erythranthe guttata] Length = 144 Score = 78.6 bits (192), Expect = 7e-16 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = +2 Query: 2 FIADSEKEKEDWINSIGRSIVQQSRSVTDNEILDYDSRK 118 FIADSEKEKEDWINSIGRSIVQ SRSVTDNEILDYDSRK Sbjct: 106 FIADSEKEKEDWINSIGRSIVQHSRSVTDNEILDYDSRK 144 >ref|XP_011076681.1| pleckstrin homology domain-containing protein 1 [Sesamum indicum] Length = 144 Score = 78.6 bits (192), Expect = 7e-16 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = +2 Query: 2 FIADSEKEKEDWINSIGRSIVQQSRSVTDNEILDYDSRK 118 FIADSEKEKEDWINSIGRSIVQ SRSVTDNEILDYDSRK Sbjct: 106 FIADSEKEKEDWINSIGRSIVQHSRSVTDNEILDYDSRK 144 >ref|XP_019192300.1| PREDICTED: pleckstrin homology domain-containing protein 1-like [Ipomoea nil] Length = 146 Score = 78.6 bits (192), Expect = 7e-16 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = +2 Query: 2 FIADSEKEKEDWINSIGRSIVQQSRSVTDNEILDYDSRK 118 FIADSEKEKEDWINSIGRSIVQ SRSVTDNEILDYDSRK Sbjct: 108 FIADSEKEKEDWINSIGRSIVQHSRSVTDNEILDYDSRK 146 >gb|EYU20025.1| hypothetical protein MIMGU_mgv1a014948mg [Erythranthe guttata] Length = 173 Score = 78.6 bits (192), Expect = 1e-15 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = +2 Query: 2 FIADSEKEKEDWINSIGRSIVQQSRSVTDNEILDYDSRK 118 FIADSEKEKEDWINSIGRSIVQ SRSVTDNEILDYDSRK Sbjct: 135 FIADSEKEKEDWINSIGRSIVQHSRSVTDNEILDYDSRK 173 >gb|EPS69948.1| hypothetical protein M569_04813 [Genlisea aurea] Length = 144 Score = 77.4 bits (189), Expect = 2e-15 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +2 Query: 2 FIADSEKEKEDWINSIGRSIVQQSRSVTDNEILDYDSRK 118 FIADSEK+KEDWINSIGRSIVQ SRSVTDNEILDYDSRK Sbjct: 106 FIADSEKDKEDWINSIGRSIVQHSRSVTDNEILDYDSRK 144 >ref|XP_016515565.1| PREDICTED: pleckstrin homology domain-containing protein 1-like [Nicotiana tabacum] ref|XP_018626947.1| PREDICTED: pleckstrin homology domain-containing protein 1-like [Nicotiana tomentosiformis] Length = 143 Score = 76.6 bits (187), Expect = 4e-15 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +2 Query: 2 FIADSEKEKEDWINSIGRSIVQQSRSVTDNEILDYDSRK 118 FIADSEKEKEDWINSIGRSIVQ SRSVTD+EILDYDSRK Sbjct: 105 FIADSEKEKEDWINSIGRSIVQHSRSVTDDEILDYDSRK 143 >gb|PIN09683.1| hypothetical protein CDL12_17735 [Handroanthus impetiginosus] Length = 144 Score = 76.6 bits (187), Expect = 4e-15 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +2 Query: 2 FIADSEKEKEDWINSIGRSIVQQSRSVTDNEILDYDSRK 118 FIADSEKEKEDWINSIGRSIVQ SRSVTDNE+LDYDS+K Sbjct: 106 FIADSEKEKEDWINSIGRSIVQHSRSVTDNEVLDYDSQK 144 >gb|PIN01781.1| hypothetical protein CDL12_25707 [Handroanthus impetiginosus] Length = 144 Score = 76.6 bits (187), Expect = 4e-15 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +2 Query: 2 FIADSEKEKEDWINSIGRSIVQQSRSVTDNEILDYDSRK 118 FIADSEKEKEDWINSIGRSIVQ SRSVTDNE+LDYDS+K Sbjct: 106 FIADSEKEKEDWINSIGRSIVQHSRSVTDNEVLDYDSQK 144 >gb|KZV52862.1| Pleckstrin (PH) domain superfamily protein [Dorcoceras hygrometricum] Length = 143 Score = 75.5 bits (184), Expect = 1e-14 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = +2 Query: 2 FIADSEKEKEDWINSIGRSIVQQSRSVTDNEILDYDSRK 118 FIADSEK+KEDWINSIGRSIVQ SRSVTDNE+LDY+SRK Sbjct: 105 FIADSEKDKEDWINSIGRSIVQHSRSVTDNEVLDYESRK 143 >ref|XP_009780334.1| PREDICTED: pleckstrin homology domain-containing protein 1-like [Nicotiana sylvestris] Length = 140 Score = 75.1 bits (183), Expect = 1e-14 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +2 Query: 2 FIADSEKEKEDWINSIGRSIVQQSRSVTDNEILDYDSRK 118 FIADSEKEKEDWINSIGRSIVQ SRSVTD+EILDYDSR+ Sbjct: 102 FIADSEKEKEDWINSIGRSIVQHSRSVTDDEILDYDSRE 140 >gb|ONI21348.1| hypothetical protein PRUPE_2G060800 [Prunus persica] Length = 120 Score = 74.3 bits (181), Expect = 2e-14 Identities = 36/44 (81%), Positives = 39/44 (88%) Frame = +2 Query: 2 FIADSEKEKEDWINSIGRSIVQQSRSVTDNEILDYDSRKSSG*R 133 FIADSEKEKEDWINSIGRSIVQ SRSVTD+E++DYDS K G R Sbjct: 74 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEVVDYDSNKCWGRR 117 >ref|XP_016471992.1| PREDICTED: pleckstrin homology domain-containing protein 1-like [Nicotiana tabacum] Length = 159 Score = 75.1 bits (183), Expect = 2e-14 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +2 Query: 2 FIADSEKEKEDWINSIGRSIVQQSRSVTDNEILDYDSRK 118 FIADSEKEKEDWINSIGRSIVQ SRSVTD+EILDYDSR+ Sbjct: 121 FIADSEKEKEDWINSIGRSIVQHSRSVTDDEILDYDSRE 159 >gb|PLY98923.1| hypothetical protein LSAT_7X35761 [Lactuca sativa] Length = 80 Score = 72.8 bits (177), Expect = 2e-14 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +2 Query: 2 FIADSEKEKEDWINSIGRSIVQQSRSVTDNEILDYDSRK 118 FIADS+KEKEDWINSIGRSIVQ SRSVTDNEI+DYDS + Sbjct: 42 FIADSKKEKEDWINSIGRSIVQHSRSVTDNEIVDYDSNR 80 >ref|XP_015877394.1| PREDICTED: pleckstrin homology domain-containing protein 1-like [Ziziphus jujuba] Length = 143 Score = 74.3 bits (181), Expect = 3e-14 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = +2 Query: 2 FIADSEKEKEDWINSIGRSIVQQSRSVTDNEILDYDSRK 118 FIADSEKEKEDWINSIGRSIVQ SRSVTD+EI+DYDS+K Sbjct: 105 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEIVDYDSKK 143 >ref|XP_015877317.1| PREDICTED: pleckstrin homology domain-containing protein 1 [Ziziphus jujuba] Length = 143 Score = 74.3 bits (181), Expect = 3e-14 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = +2 Query: 2 FIADSEKEKEDWINSIGRSIVQQSRSVTDNEILDYDSRK 118 FIADSEKEKEDWINSIGRSIVQ SRSVTD+EI+DYDS+K Sbjct: 105 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEIVDYDSKK 143 >ref|XP_023771079.1| pleckstrin homology domain-containing protein 1 [Lactuca sativa] gb|PLY79923.1| hypothetical protein LSAT_8X12501 [Lactuca sativa] Length = 144 Score = 74.3 bits (181), Expect = 3e-14 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +2 Query: 2 FIADSEKEKEDWINSIGRSIVQQSRSVTDNEILDYDSRK 118 FIADSEKEKEDWINSIGRSIVQ SRSVTDNEI+DYDS + Sbjct: 106 FIADSEKEKEDWINSIGRSIVQHSRSVTDNEIVDYDSNR 144