BLASTX nr result
ID: Rehmannia32_contig00019650
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00019650 (457 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46278.1| hypothetical protein MIMGU_mgv1a000474mg [Erythra... 64 7e-09 ref|XP_012829739.1| PREDICTED: chromatin structure-remodeling co... 64 7e-09 >gb|EYU46278.1| hypothetical protein MIMGU_mgv1a000474mg [Erythranthe guttata] Length = 1129 Score = 63.9 bits (154), Expect = 7e-09 Identities = 37/78 (47%), Positives = 48/78 (61%) Frame = -1 Query: 454 STIPEGHKDTPGNESGELLTDEDPKDNPTVEVSVWTTEAGVSEDESRLCEEQILQEQDCD 275 +TI E DTPGNES ELL DE +EV + TTE G+S+ S + EE+I E +C Sbjct: 834 NTISEALGDTPGNESPELLIDEHAA--APLEVPI-TTEIGLSQSGSHMNEEEIPGELECG 890 Query: 274 ETLTDKDLDSKPESTECP 221 + + D D+DSKPE E P Sbjct: 891 DDIMDTDVDSKPEPKEAP 908 >ref|XP_012829739.1| PREDICTED: chromatin structure-remodeling complex protein SYD [Erythranthe guttata] Length = 3399 Score = 63.9 bits (154), Expect = 7e-09 Identities = 37/78 (47%), Positives = 48/78 (61%) Frame = -1 Query: 454 STIPEGHKDTPGNESGELLTDEDPKDNPTVEVSVWTTEAGVSEDESRLCEEQILQEQDCD 275 +TI E DTPGNES ELL DE +EV + TTE G+S+ S + EE+I E +C Sbjct: 3104 NTISEALGDTPGNESPELLIDEHAA--APLEVPI-TTEIGLSQSGSHMNEEEIPGELECG 3160 Query: 274 ETLTDKDLDSKPESTECP 221 + + D D+DSKPE E P Sbjct: 3161 DDIMDTDVDSKPEPKEAP 3178