BLASTX nr result
ID: Rehmannia32_contig00019578
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00019578 (595 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011093042.1| uncharacterized protein LOC105173090 [Sesamu... 62 1e-07 >ref|XP_011093042.1| uncharacterized protein LOC105173090 [Sesamum indicum] Length = 1351 Score = 62.0 bits (149), Expect = 1e-07 Identities = 29/34 (85%), Positives = 29/34 (85%) Frame = +1 Query: 1 SLGPVGLPGMDEHLQLNEGTRARAFEDQRRHGSS 102 SLGPVGLPGMDE QLNEGTRAR FED R HGSS Sbjct: 1300 SLGPVGLPGMDEQSQLNEGTRARTFEDHRLHGSS 1333