BLASTX nr result
ID: Rehmannia32_contig00019389
seq
BLASTX 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= Rehmannia32_contig00019389
(365 letters)
Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects
149,584,005 sequences; 54,822,741,787 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
gb|ATG83018.1| photosystem II protein M (chloroplast) [Phoenix d... 98 2e-24
ref|WP_078101538.1| photosystem II reaction center protein PsbM ... 90 2e-21
gb|KJB80637.1| hypothetical protein B456_013G108100 [Gossypium r... 87 1e-20
dbj|GAY33504.1| hypothetical protein CUMW_286780 [Citrus unshiu] 82 1e-18
ref|YP_009409886.1| photosystem II protein M (chloroplast) [Cres... 71 4e-16
gb|ANF05123.1| photosystem II protein M (chloroplast) [Cynanchum... 75 1e-15
gb|ADD63027.1| photosystem II protein M (chloroplast) [Potamophi... 71 7e-14
ref|WP_082924831.1| photosystem II reaction center protein PsbM,... 70 7e-14
gb|AVM81381.1| photosystem II protein M (chloroplast) [Adenocaly... 70 1e-13
gb|AAS46110.1| photosystem II M protein (chloroplast) [Oryza sat... 70 1e-13
ref|YP_009366249.1| PSII M protein (plastid) [Aloysia citrodora]... 67 8e-13
ref|YP_009354399.1| photosystem II protein M (chloroplast) [Cycl... 67 8e-13
ref|YP_009186162.1| photosystem II protein M (chloroplast) [Jugl... 67 8e-13
gb|ADD63094.1| photosystem II protein M (chloroplast) [Microlaen... 68 8e-13
ref|YP_009040786.1| photosystem II protein M (chloroplast) (chlo... 67 1e-12
ref|NP_051053.1| photosystem II protein M [Arabidopsis thaliana]... 67 2e-12
ref|YP_009407099.1| photosystem II protein M (chloroplast) [Plat... 67 2e-12
gb|ATV97192.1| photosystem II protein M (chloroplast) [Allantoma... 67 2e-12
ref|YP_009375686.1| PsbM (chloroplast) [Diplostephium phylicoide... 66 2e-12
gb|AKZ30297.1| photosystem II protein M (chloroplast) [Goodenia ... 66 2e-12
>gb|ATG83018.1| photosystem II protein M (chloroplast) [Phoenix dactylifera]
Length = 70
Score = 97.8 bits (242), Expect = 2e-24
Identities = 50/60 (83%), Positives = 55/60 (91%)
Frame = +2
Query: 20 IEFTDERFIISRGLNPELLRSKKTDEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQN 199
+E T +F+IS GL+PELLRSKK +EIMEVNILAFIATALFILVPTAFLLIIYVKTVSQN
Sbjct: 11 VELTGVKFLISMGLDPELLRSKKNNEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQN 70
>ref|WP_078101538.1| photosystem II reaction center protein PsbM [Staphylococcus aureus]
gb|KJB13068.1| hypothetical protein B456_002G055100 [Gossypium raimondii]
Length = 50
Score = 89.7 bits (221), Expect = 2e-21
Identities = 46/49 (93%), Positives = 48/49 (97%)
Frame = +2
Query: 56 GLNPELLRSKKTDEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQND 202
GLNPELLRSKK +EIMEVNILAFIATALFILVPTAFLLIIYVKTVSQ+D
Sbjct: 2 GLNPELLRSKKNNEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQSD 50
>gb|KJB80637.1| hypothetical protein B456_013G108100 [Gossypium raimondii]
Length = 50
Score = 87.4 bits (215), Expect = 1e-20
Identities = 44/49 (89%), Positives = 47/49 (95%)
Frame = +2
Query: 56 GLNPELLRSKKTDEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQND 202
GLNPELLRSKK +EIMEVNILAFIATALFILVPTAFLLIIYVKT+ Q+D
Sbjct: 2 GLNPELLRSKKNNEIMEVNILAFIATALFILVPTAFLLIIYVKTICQSD 50
>dbj|GAY33504.1| hypothetical protein CUMW_286780 [Citrus unshiu]
Length = 53
Score = 82.4 bits (202), Expect = 1e-18
Identities = 44/52 (84%), Positives = 46/52 (88%), Gaps = 3/52 (5%)
Frame = +2
Query: 56 GLNPELLRSKK---TDEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQND 202
GLNPELLRSKK DE MEVNILAFIAT LF+LVPTAFLLIIYVKTVSQ+D
Sbjct: 2 GLNPELLRSKKKKPNDETMEVNILAFIATTLFVLVPTAFLLIIYVKTVSQSD 53
>ref|YP_009409886.1| photosystem II protein M (chloroplast) [Cressa cretica]
gb|ASJ65073.1| photosystem II protein M (chloroplast) [Cressa cretica]
Length = 79
Score = 71.2 bits (173), Expect(2) = 4e-16
Identities = 36/40 (90%), Positives = 38/40 (95%)
Frame = +2
Query: 83 KKTDEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQND 202
K+ DEIMEVNILAFIATALFILVPTAF LIIYVKTVSQ+D
Sbjct: 40 KRRDEIMEVNILAFIATALFILVPTAFFLIIYVKTVSQSD 79
Score = 41.2 bits (95), Expect(2) = 4e-16
Identities = 21/28 (75%), Positives = 23/28 (82%)
Frame = +1
Query: 16 IH*IYRRKIYHL*GIKSRVIAK*KNR*D 99
IH I++RKIYHL GIKSRVIAK K R D
Sbjct: 16 IHCIFKRKIYHLYGIKSRVIAKLKKRRD 43
>gb|ANF05123.1| photosystem II protein M (chloroplast) [Cynanchum auriculatum]
Length = 50
Score = 75.1 bits (183), Expect = 1e-15
Identities = 34/41 (82%), Positives = 36/41 (87%)
Frame = +1
Query: 76 AK*KNR*DYGSKYSCIYCYCTIHSSSYRFSTYHLRKNSQSK 198
+K K R DYGSKYSCI CYCTIHSSSYR STYHLRKN+QSK
Sbjct: 10 SKKKKRLDYGSKYSCICCYCTIHSSSYRLSTYHLRKNNQSK 50
>gb|ADD63027.1| photosystem II protein M (chloroplast) [Potamophila parviflora]
Length = 69
Score = 70.9 bits (172), Expect = 7e-14
Identities = 41/61 (67%), Positives = 43/61 (70%)
Frame = +2
Query: 20 IEFTDERFIISRGLNPELLRSKKTDEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQN 199
+EFT F P K E+MEVNILAFIATALFILVPTAFLLIIYVKTVSQN
Sbjct: 12 LEFTGYPFYSPWDYIPSYCEKK---EVMEVNILAFIATALFILVPTAFLLIIYVKTVSQN 68
Query: 200 D 202
D
Sbjct: 69 D 69
>ref|WP_082924831.1| photosystem II reaction center protein PsbM, partial
[Paenarthrobacter nicotinovorans]
Length = 39
Score = 70.1 bits (170), Expect = 7e-14
Identities = 36/39 (92%), Positives = 38/39 (97%)
Frame = +2
Query: 86 KTDEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQND 202
K +EIMEVNILAFIATALFILVPTAFLLIIYVKTVSQ+D
Sbjct: 1 KKNEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQSD 39
>gb|AVM81381.1| photosystem II protein M (chloroplast) [Adenocalymma acutissimum]
gb|AVM81468.1| photosystem II protein M (chloroplast) [Adenocalymma divaricatum]
Length = 37
Score = 69.7 bits (169), Expect = 1e-13
Identities = 36/37 (97%), Positives = 36/37 (97%)
Frame = +2
Query: 101 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND*FN 211
MEVNILAFIATALFILVPTAFLLIIYVKTVSQND FN
Sbjct: 1 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNDSFN 37
>gb|AAS46110.1| photosystem II M protein (chloroplast) [Oryza sativa Japonica
Group]
gb|AAS46173.1| photosystem II M protein (chloroplast) [Oryza sativa Japonica
Group]
gb|ADD62823.1| photosystem II protein M (chloroplast) [Oryza sativa Japonica
Group]
gb|ADD62891.1| photosystem II protein M (chloroplast) [Oryza meridionalis]
gb|ADD62959.1| photosystem II protein M (chloroplast) [Oryza australiensis]
gb|AGY48933.1| photosystem II reaction center protein M (chloroplast) [Oryza
rufipogon]
Length = 69
Score = 70.1 bits (170), Expect = 1e-13
Identities = 41/61 (67%), Positives = 43/61 (70%)
Frame = +2
Query: 20 IEFTDERFIISRGLNPELLRSKKTDEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQN 199
+EFT F P K E+MEVNILAFIATALFILVPTAFLLIIYVKTVSQN
Sbjct: 12 LEFTGYPFPSPWDYIPSYCEKK---EVMEVNILAFIATALFILVPTAFLLIIYVKTVSQN 68
Query: 200 D 202
D
Sbjct: 69 D 69
>ref|YP_009366249.1| PSII M protein (plastid) [Aloysia citrodora]
gb|ARJ61921.1| PSII M protein (plastid) [Aloysia citrodora]
Length = 37
Score = 67.4 bits (163), Expect = 8e-13
Identities = 35/36 (97%), Positives = 35/36 (97%)
Frame = +2
Query: 101 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND*F 208
MEVNILAFIATALFILVPTAFLLIIYVKTVSQND F
Sbjct: 1 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNDSF 36
>ref|YP_009354399.1| photosystem II protein M (chloroplast) [Cyclocarya paliurus]
gb|ARA90741.1| photosystem II protein M (chloroplast) [Cyclocarya paliurus]
Length = 37
Score = 67.4 bits (163), Expect = 8e-13
Identities = 35/36 (97%), Positives = 35/36 (97%)
Frame = +2
Query: 101 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND*F 208
MEVNILAFIATALFILVPTAFLLIIYVKTVSQND F
Sbjct: 1 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNDSF 36
>ref|YP_009186162.1| photosystem II protein M (chloroplast) [Juglans regia]
ref|YP_009306650.1| photosystem II protein M (chloroplast) [Juglans sigillata]
ref|YP_009347442.1| photosystem II protein M (chloroplast) [Juglans mandshurica]
ref|YP_009347528.1| photosystem II protein M (chloroplast) [Juglans cathayensis]
ref|YP_009347614.1| photosystem II protein M (chloroplast) [Juglans hopeiensis]
ref|YP_009430708.1| photosystem II protein M (chloroplast) [Juglans cinerea]
ref|YP_009430792.1| photosystem II protein M (chloroplast) [Juglans hindsii]
ref|YP_009430875.1| photosystem II protein M (chloroplast) [Juglans major]
ref|YP_009430958.1| photosystem II protein M (chloroplast) [Juglans nigra]
gb|ALO71557.1| photosystem II protein M (chloroplast) [Juglans regia]
gb|ANG44774.1| photosystem II protein M (chloroplast) [Juglans regia]
gb|AOQ30849.1| photosystem II protein M (chloroplast) [Juglans sigillata]
gb|APW28890.1| photosystem II protein M (chloroplast) [Juglans mandshurica]
gb|APW28976.1| photosystem II protein M (chloroplast) [Juglans cathayensis]
gb|APW29062.1| photosystem II protein M (chloroplast) [Juglans hopeiensis]
gb|AQT38477.1| photosystem II protein M (chloroplast) [Annamocarya sinensis]
gb|ASM81858.1| photosystem II protein M (chloroplast) [Juglans cathayensis]
gb|ASM81940.1| photosystem II protein M (chloroplast) [Juglans cinerea]
gb|ASM82025.1| photosystem II protein M (chloroplast) [Juglans hindsii]
gb|ASM82107.1| photosystem II protein M (chloroplast) [Juglans major]
gb|ASM82191.1| photosystem II protein M (chloroplast) [Juglans mandshurica]
gb|ASM82274.1| photosystem II protein M (chloroplast) [Juglans nigra]
gb|ASM82357.1| photosystem II protein M (chloroplast) [Juglans regia]
gb|ASM82441.1| photosystem II protein M (chloroplast) [Juglans regia]
gb|ASM82523.1| photosystem II protein M (chloroplast) [Juglans sigillata]
Length = 37
Score = 67.4 bits (163), Expect = 8e-13
Identities = 35/36 (97%), Positives = 35/36 (97%)
Frame = +2
Query: 101 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND*F 208
MEVNILAFIATALFILVPTAFLLIIYVKTVSQND F
Sbjct: 1 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNDSF 36
>gb|ADD63094.1| photosystem II protein M (chloroplast) [Microlaena stipoides]
Length = 69
Score = 68.2 bits (165), Expect = 8e-13
Identities = 34/36 (94%), Positives = 35/36 (97%)
Frame = +2
Query: 95 EIMEVNILAFIATALFILVPTAFLLIIYVKTVSQND 202
E+MEVNILAFIATALFILVPTAFLLIIYVKT SQND
Sbjct: 34 EVMEVNILAFIATALFILVPTAFLLIIYVKTASQND 69
>ref|YP_009040786.1| photosystem II protein M (chloroplast) (chloroplast) [Centaurea
diffusa]
ref|YP_009235797.1| photosystem II reaction center protein (chloroplast) [Saussurea
involucrata]
ref|YP_009341771.1| photosystem II protein M (chloroplast) [Castanopsis concinna]
ref|YP_009460497.1| photosystem II reaction center protein M (plastid) [Cirsium
arvense]
ref|YP_009460585.1| photosystem II protein M (plastid) [Cirsium eriophorum]
ref|YP_009460673.1| photosystem II protein M (plastid) [Cirsium vulgare]
gb|AIB03740.1| photosystem II protein M (chloroplast) (chloroplast) [Centaurea
diffusa]
gb|AKF00090.1| photosystem II protein M (chloroplast) [Orania palindan]
gb|AKF00165.1| photosystem II protein M (chloroplast) [Pelagodoxa henryana]
gb|AKF00239.1| photosystem II protein M (chloroplast) [Podococcus barteri]
gb|AKF00299.1| photosystem II protein M (chloroplast) [Prestoea acuminata var.
montana]
gb|AKF00356.1| photosystem II protein M (chloroplast) [Reinhardtia gracilis]
gb|AKF00431.1| photosystem II protein M (chloroplast) [Reinhardtia latisecta]
gb|AKF00495.1| photosystem II protein M (chloroplast) [Roystonea regia]
gb|AKF00635.1| photosystem II protein M (chloroplast) [Reinhardtia simplex]
gb|AKF00696.1| photosystem II protein M (chloroplast) [Satakentia liukiuensis]
gb|AKF00768.1| photosystem II protein M (chloroplast) [Sclerosperma profizianum]
gb|AKF00992.1| photosystem II protein M (chloroplast) [Attalea speciosa]
gb|AKF01068.1| photosystem II protein M (chloroplast) [Bactris major]
gb|AKF01144.1| photosystem II protein M (chloroplast) [Beccariophoenix
madagascariensis]
gb|AKF01226.1| photosystem II protein M (chloroplast) [Burretiokentia grandiflora]
gb|AKF01290.1| photosystem II protein M (chloroplast) [Dictyosperma album]
gb|AKF01368.1| photosystem II protein M (chloroplast) [Drymophloeus litigiosus]
gb|AKF01440.1| photosystem II protein M (chloroplast) [Dypsis decaryi]
gb|AKF01525.1| photosystem II protein M (chloroplast) [Geonoma undata subsp.
dussiana]
gb|AKF01600.1| photosystem II protein M (chloroplast) [Heterospathe cagayanensis]
gb|AKF01681.1| photosystem II protein M (chloroplast) [Hydriastele microspadix]
gb|AKF01846.1| photosystem II protein M (chloroplast) [Kentiopsis piersoniorum]
gb|AKF01910.1| photosystem II protein M (chloroplast) [Leopoldinia pulchra]
gb|AKF02070.1| photosystem II protein M (chloroplast) [Oenocarpus bataua]
gb|AKF02131.1| photosystem II protein M (chloroplast) [Oenocarpus minor]
gb|ALN96566.1| photosystem II protein M (chloroplast) [Castanopsis concinna]
gb|AMD61937.1| photosystem II reaction center protein (chloroplast) [Saussurea
involucrata]
gb|AUT81862.1| photosystem II reaction center protein M (plastid) [Cirsium
arvense]
gb|AUT81950.1| photosystem II protein M (plastid) [Cirsium eriophorum]
gb|AUT82038.1| photosystem II protein M (plastid) [Cirsium vulgare]
Length = 35
Score = 67.0 bits (162), Expect = 1e-12
Identities = 34/35 (97%), Positives = 35/35 (100%)
Frame = +2
Query: 98 IMEVNILAFIATALFILVPTAFLLIIYVKTVSQND 202
+MEVNILAFIATALFILVPTAFLLIIYVKTVSQND
Sbjct: 1 MMEVNILAFIATALFILVPTAFLLIIYVKTVSQND 35
>ref|NP_051053.1| photosystem II protein M [Arabidopsis thaliana]
ref|NP_054490.1| photosystem II protein M [Nicotiana tabacum]
ref|NP_039371.1| photosystem II protein M (plastid) [Oryza sativa Japonica Group]
ref|NP_054926.1| photosystem II protein M (plastid) [Spinacia oleracea]
ref|NP_783226.1| photosystem II protein M [Atropa belladonna]
ref|YP_052737.1| photosystem II protein M (chloroplast) [Oryza nivara]
ref|YP_053149.1| photosystem II protein M [Nymphaea alba]
ref|YP_319759.1| photosystem II protein M [Acorus calamus]
ref|YP_358667.1| photosystem II protein M [Nicotiana sylvestris]
ref|YP_358572.1| photosystem II protein M [Phalaenopsis aphrodite subsp. formosana]
ref|YP_398854.1| photosystem II protein M [Nicotiana tomentosiformis]
ref|YP_538842.1| photosystem II protein M [Solanum bulbocastanum]
ref|YP_588103.1| photosystem II protein M (chloroplast) [Helianthus annuus]
ref|YP_635633.1| photosystem II protein M [Solanum tuberosum]
ref|YP_740196.1| photosystem II protein M [Liriodendron tulipifera]
ref|YP_740559.1| photosystem II protein M [Platanus occidentalis]
ref|YP_778484.1| photosystem II protein M [Jasminum nudiflorum]
ref|YP_784380.1| photosystem II protein M [Drimys granadensis]
ref|YP_001001528.1| photosystem II protein M [Nuphar advena]
ref|YP_001004180.1| photosystem II protein M [Ranunculus macranthus]
ref|YP_001123367.1| photosystem II protein M [Capsella bursa-pastoris]
ref|YP_001123280.1| PSII low MW protein [Barbarea verna]
ref|YP_001123631.1| photosystem II protein M [Lepidium virginicum]
ref|YP_001123808.1| photosystem II protein M [Nasturtium officinale]
ref|YP_001123109.1| photosystem II protein M [Olimarabidopsis pumila]
ref|YP_001123456.1| photosystem II protein M [Crucihimalaya wallichii]
ref|YP_001294092.1| photosystem II protein M [Chloranthus spicatus]
ref|YP_001294346.1| photosystem II protein M [Dioscorea elephantipes]
ref|YP_001294264.1| photosystem II protein M [Illicium oligandrum]
ref|YP_001294178.1| photosystem II protein M [Buxus microphylla]
ref|YP_001468302.1| photosystem II protein M [Ipomoea purpurea]
ref|YP_001586176.1| photosystem II protein M [Acorus americanus]
ref|YP_001595502.1| PSII M protein [Lemna minor]
ref|YP_001837346.1| photosystem II protein M [Guizotia abyssinica]
ref|YP_001936511.1| photosystem II protein M [Fagopyrum esculentum subsp. ancestrale]
ref|YP_002836084.1| photosystem II protein M [Megaleranthis saniculifolia]
ref|YP_003029728.1| PsbM (chloroplast) [Bambusa oldhamii]
ref|YP_003097564.1| photosystem II protein M (chloroplast) [Dendrocalamus latiflorus]
ref|YP_003359353.1| photosystem II protein M (chloroplast) [Olea europaea]
ref|YP_003433969.1| photosystem II protein M [Typha latifolia]
ref|YP_003540925.1| photosystem II protein M [Phoenix dactylifera]
ref|YP_003587656.1| photosystem II protein M [Anomochloa marantoidea]
ref|YP_004021144.1| photosystem II protein M [Castanea mollissima]
ref|YP_004376415.1| photosystem II protein M [Olea europaea subsp. europaea]
ref|YP_004563861.1| photosystem II protein M [Nelumbo lutea]
ref|YP_004563775.1| photosystem II protein M [Olea europaea subsp. cuspidata]
ref|YP_004563998.1| photosystem II protein M [Olea woodiana subsp. woodiana]
ref|YP_004564358.1| photosystem II protein M (chloroplast) [Ageratina adenophora]
ref|YP_004564491.1| photosystem II protein M [Olea europaea subsp. maroccana]
ref|YP_004733233.1| photosystem II protein M (plastid) [Indocalamus longiauritus]
ref|YP_004733567.1| photosystem II protein M (chloroplast) [Phyllostachys edulis]
ref|YP_004733749.1| photosystem II protein M (chloroplast) [Acidosasa purpurea]
ref|YP_004733967.1| photosystem II protein M (chloroplast) [Phyllostachys nigra var.
henonis]
ref|YP_004734090.1| photosystem II protein M (chloroplast) [Bambusa emeiensis]
ref|YP_004734174.1| photosystem II protein M (plastid) [Ferrocalamus rimosivaginus]
ref|YP_004769624.1| photosystem II protein M (chloroplast) [Spirodela polyrhiza]
ref|YP_004769708.1| photosystem II protein M [Magnolia kwangsiensis]
ref|YP_004769806.1| photosystem II protein M (chloroplast) [Wolffiella lingulata]
ref|YP_004769941.1| photosystem II protein M (chloroplast) [Wolffia australiana]
ref|YP_004891595.1| psbM gene product (chloroplast) [Nicotiana undulata]
ref|YP_004935660.1| PSII M protein (chloroplast) [Sesamum indicum]
ref|YP_004940504.1| psbM gene product (chloroplast) [Dorcoceras hygrometricum]
ref|YP_005087998.1| psbM gene product [Leersia tisserantii]
ref|YP_005088521.1| psbM gene product (chloroplast) [Phyllostachys propinqua]
ref|YP_005089135.1| psbM gene product [Rhynchoryza subulata]
ref|YP_005089328.1| psbM gene product (chloroplast) [Silene vulgaris]
ref|YP_005089409.1| psbM gene product (chloroplast) [Silene noctiflora]
ref|YP_005089490.1| psbM gene product (chloroplast) [Silene conica]
ref|YP_005089571.1| psbM gene product (chloroplast) [Silene latifolia]
ref|YP_005097868.1| photosystem II protein M (chloroplast) [Colocasia esculenta]
ref|YP_005296407.1| psbM gene product (chloroplast) [Oryza meridionalis]
ref|YP_006073098.1| photosystem II protein M (chloroplast) [Elaeis guineensis]
ref|YP_006073262.1| photosystem II protein M (chloroplast) [Phalaenopsis equestris]
ref|YP_006280748.1| psbM gene product (chloroplast) [Oryza rufipogon]
ref|YP_006503785.1| photosystem II M protein (chloroplast) [Datura stramonium]
ref|YP_006576109.1| PsbM (chloroplast) [Magnolia denudata]
ref|YP_006665774.1| photosystem II protein M (chloroplast) [Elodea canadensis]
ref|YP_006666024.1| photosystem II protein M (chloroplast) [Capsicum annuum]
ref|YP_007317242.1| PSII M protein (chloroplast) [Camellia sinensis]
ref|YP_007353909.1| photosystem II protein M (chloroplast) [Tectona grandis]
ref|YP_007375037.1| photosystem II protein M [Quercus rubra]
ref|YP_007474364.1| photosystem II M protein (chloroplast) [Magnolia officinalis]
ref|YP_007474446.1| photosystem II M protein (chloroplast) [Magnolia officinalis subsp.
biloba]
ref|YP_007474530.1| photosystem II M protein (chloroplast) [Magnolia grandiflora]
ref|YP_007475128.1| photosystem II protein M (chloroplast) [Arundinaria gigantea]
ref|YP_007475613.1| photosystem II protein M [Heliconia collinsiana]
ref|YP_007475698.1| photosystem II protein M [Zingiber spectabile]
ref|YP_007475783.1| photosystem II protein M [Pseudophoenix vinifera]
ref|YP_007475955.1| photosystem II protein M [Bismarckia nobilis]
ref|YP_007476041.1| photosystem II protein M (plastid) [Dasypogon bromeliifolius]
ref|YP_007475869.1| photosystem II protein M [Calamus caryotoides]
ref|YP_007476345.1| PsbM (chloroplast) [Trithuria inconspicua]
ref|YP_007507105.1| photosystem II M protein (chloroplast) [Salvia miltiorrhiza]
ref|YP_007889936.1| photosystem II protein M (chloroplast) [Pachycladon cheesemanii]
ref|YP_008081259.1| photosystem II protein M (chloroplast) (chloroplast) [Catharanthus
roseus]
ref|YP_008081359.1| photosystem II protein M (chloroplast) [Tetracentron sinense]
ref|YP_008081451.1| photosystem II protein M (chloroplast) [Trochodendron aralioides]
ref|YP_008082575.1| photosystem II protein M (chloroplast) [Utricularia gibba]
ref|YP_008378780.1| photosystem II protein M (chloroplast) [Najas flexilis]
ref|YP_008520133.1| photosystem II protein M (chloroplast) [Camellia taliensis]
ref|YP_008563082.1| photosystem II protein M (chloroplast) [Solanum lycopersicum]
ref|YP_008578279.1| photosystem II protein M (chloroplast) [Cocos nucifera]
ref|YP_008592751.1| photosystem II protein M (chloroplast) [Camellia cuspidata]
ref|YP_008592840.1| photosystem II protein M (chloroplast) [Camellia danzaiensis]
ref|YP_008592927.1| photosystem II protein M (chloroplast) [Camellia impressinervis]
ref|YP_008593105.1| photosystem II protein M (chloroplast) [Camellia yunnanensis]
ref|YP_008592482.1| PSII M protein (chloroplast) [Andrographis paniculata]
ref|YP_008593016.1| photosystem II protein M (chloroplast) [Camellia pitardii]
ref|YP_008815931.1| photosystem II protein M (chloroplast) [Lindenbergia philippensis]
ref|YP_008854419.1| photosystem II protein M [Musa textilis]
ref|YP_008854505.1| photosystem II protein M [Ravenala madagascariensis]
ref|YP_008854588.1| photosystem II protein M [Curcuma roscoeana]
ref|YP_008963300.1| photosystem II protein M [Camellia oleifera]
ref|YP_008963474.1| photosystem II protein M (chloroplast) [Penthorum chinense]
ref|YP_008964343.1| photosystem II protein M [Helianthus divaricatus]
ref|YP_008964428.1| photosystem II protein M [Helianthus decapetalus]
ref|YP_008964683.1| photosystem II protein M [Helianthus strumosus]
ref|YP_008964768.1| photosystem II protein M [Helianthus maximiliani]
ref|YP_008964028.1| photosystem II protein M [Ajuga reptans]
ref|YP_008964173.1| photosystem II protein M [Helianthus giganteus]
ref|YP_008964258.1| photosystem II protein M [Helianthus grosseserratus]
ref|YP_008964513.1| photosystem II protein M [Helianthus hirsutus]
ref|YP_008964598.1| photosystem II protein M [Helianthus tuberosus]
ref|YP_008993963.1| photosystem II protein M (chloroplast) [Pharus lappulaceus]
ref|YP_008993170.1| photosystem II protein M (chloroplast) [Magnolia cathcartii]
ref|YP_008993256.1| photosystem II protein M (chloroplast) [Magnolia macrophylla var.
dealbata]
ref|YP_008993342.1| photosystem II protein M (chloroplast) [Magnolia pyramidata]
ref|YP_008993428.1| photosystem II protein M (chloroplast) [Magnolia kobus]
ref|YP_008993514.1| photosystem II protein M (chloroplast) [Magnolia liliifera]
ref|YP_008993600.1| photosystem II protein M (chloroplast) [Magnolia odora]
ref|YP_008993772.1| photosystem II protein M (chloroplast) [Magnolia sinica]
ref|YP_008993858.1| photosystem II protein M (chloroplast) [Magnolia sprengeri]
ref|YP_008993686.1| photosystem II protein M (chloroplast) [Magnolia salicifolia]
ref|YP_008964861.1| photosystem II protein M (chloroplast) [Schwalbea americana]
ref|YP_009000009.1| photosystem II protein M (chloroplast) [Silene conoidea]
ref|YP_009000170.1| photosystem II protein M (chloroplast) [Silene paradoxa]
ref|YP_009000090.1| photosystem II protein M (chloroplast) [Silene chalcedonica]
ref|YP_009001981.1| photosystem II protein M (chloroplast) [Puelia olyriformis]
ref|YP_009002252.1| photosystem II protein M (chloroplast) [Pinguicula ehlersiae]
ref|YP_009020214.1| photosystem II protein M (chloroplast) [Castanopsis echinocarpa]
ref|YP_009020729.1| photosystem II protein M (chloroplast) [Praxelis clematidea]
ref|YP_009024243.1| photosystem II protein M (chloroplast) [Arundinaria appalachiana]
ref|YP_009024326.1| photosystem II protein M (chloroplast) [Arundinaria tecta]
ref|YP_009024787.1| photosystem II protein M (chloroplast) [Trigonobalanus
doichangensis]
ref|YP_009026875.1| photosystem II protein M (plastid) [Magnolia tripetala]
ref|YP_009033432.1| photosystem II protein M (plastid) [Olyra latifolia]
ref|YP_009034085.1| photosystem II protein M (plastid) [Oryza glaberrima]
ref|YP_009033879.1| photosystem II protein M (plastid) [Dioscorea rotundata]
ref|YP_009040312.1| photosystem II protein M [Hyoscyamus niger]
ref|YP_009041081.1| photosystem II protein M [Rhazya stricta]
ref|YP_009047926.1| photosystem II protein M (chloroplast) [Camellia crapnelliana]
ref|YP_009048015.1| photosystem II protein M (chloroplast) [Nymphaea mexicana]
ref|YP_009048281.1| photosystem II protein M (chloroplast) [Magnolia yunnanensis]
ref|YP_009049257.1| photosystem II protein M (chloroplast) [Oryza australiensis]
ref|YP_009050582.1| photosystem II protein M (chloroplast) [Camellia grandibracteata]
ref|YP_009050669.1| photosystem II protein M (chloroplast) [Camellia leptophylla]
ref|YP_009050756.1| photosystem II protein M (chloroplast) [Camellia petelotii]
ref|YP_009050843.1| photosystem II protein M (chloroplast) [Camellia pubicosta]
ref|YP_009050930.1| photosystem II protein M (chloroplast) [Camellia reticulata]
ref|YP_009051239.1| photosystem II protein M (chloroplast) [Bambusa multiplex]
ref|YP_009051324.1| photosystem II protein M (chloroplast) [Phyllostachys sulphurea]
ref|YP_009052573.1| photosystem II protein M (chloroplast) [Arundinaria fargesii]
ref|YP_009052656.1| photosystem II protein M (chloroplast) [Sarocalamus faberi]
ref|YP_009052740.1| photosystem II protein M (chloroplast) [Chimonocalamus
longiusculus]
ref|YP_009052822.1| photosystem II protein M (chloroplast) [Fargesia nitida]
ref|YP_009052905.1| photosystem II protein M (chloroplast) [Fargesia spathacea]
ref|YP_009052988.1| photosystem II protein M (chloroplast) [Fargesia yunnanensis]
ref|YP_009053071.1| photosystem II protein M (chloroplast) [Gaoligongshania
megalothyrsa]
ref|YP_009053154.1| photosystem II protein M (chloroplast) [Gelidocalamus tessellatus]
ref|YP_009053237.1| photosystem II protein M (chloroplast) [Indocalamus wilsonii]
ref|YP_009053320.1| photosystem II protein M (chloroplast) [Indosasa sinica]
ref|YP_009053402.1| photosystem II protein M (chloroplast) [Oligostachyum
shiuyingianum]
ref|YP_009053649.1| photosystem II protein M (chloroplast) [Yushania levigata]
ref|YP_009053484.1| photosystem II protein M (chloroplast) [Pleioblastus maculatus]
ref|YP_009053566.1| photosystem II protein M (chloroplast) [Thamnocalamus spathiflorus]
ref|YP_009053868.1| photosystem II protein M (plastid) [Ampelocalamus calcareus]
ref|YP_009093944.1| photosystem II protein M (chloroplast) [Nelumbo nucifera]
ref|YP_009092761.1| photosystem II protein M [Bomarea edulis]
ref|YP_009093794.1| photosystem II protein M (chloroplast) [Luzuriaga radicans]
ref|YP_009108435.1| photosystem II protein M (chloroplast) [Genlisea margaretae]
ref|YP_009107557.1| photosystem II protein M (chloroplast) [Phalaenopsis hybrid
cultivar]
ref|YP_009108492.1| photosystem II protein M (chloroplast) [Utricularia macrorhiza]
ref|YP_009110596.1| photosystem II protein M (chloroplast) [Hesperelaea palmeri]
ref|YP_009108668.1| photosystem II protein M [Nerium oleander]
ref|YP_009114863.1| photosystem II protein M [Thalictrum coreanum]
ref|YP_009116336.1| photosystem II protein M (chloroplast) [Ananas comosus]
ref|YP_009117215.1| photosystem II protein M (chloroplast) [Premna microphylla]
ref|YP_009117669.1| photosystem II protein M (plastid) [Acorus gramineus]
ref|YP_009128065.1| photosystem II protein M (chloroplast) [Actinidia deliciosa]
ref|YP_009128175.1| photosystem II protein M (chloroplast) [Saracha punctata]
ref|YP_009128385.1| photosystem II protein M (chloroplast) [Ipomoea batatas]
ref|YP_009128834.1| photosystem II protein M (chloroplast) [Iochroma loxense]
ref|YP_009123246.1| photosystem II protein M (chloroplast) [Chloranthus japonicus]
ref|YP_009123627.1| photosystem II protein M (chloroplast) [Iochroma stenanthum]
ref|YP_009123736.1| photosystem II protein M [Lithocarpus balansae]
ref|YP_009127982.1| photosystem II protein M (chloroplast) [Actinidia chinensis]
ref|YP_009123151.1| photosystem II protein M (chloroplast) [Dunalia obovata]
ref|YP_009123345.1| photosystem II protein M (chloroplast) [Iochroma nitidum]
ref|YP_009129354.1| photosystem II protein M (chloroplast) [Cypripedium formosanum]
ref|YP_009130121.1| photosystem II protein M (chloroplast) [Carludovica palmata]
ref|YP_009130316.1| photosystem II protein M (chloroplast) [Quercus aliena]
ref|YP_009131707.1| photosystem II protein M (chloroplast) [Solanum cheesmaniae]
ref|YP_009131956.1| photosystem II protein M (chloroplast) [Solanum habrochaites]
ref|YP_009132039.1| photosystem II protein M (chloroplast) [Solanum neorickii]
ref|YP_009132830.1| photosystem II protein M (chloroplast) [Quercus spinosa]
ref|YP_009133049.1| photosystem II protein M (chloroplast) [Quercus aquifolioides]
ref|YP_009131790.1| photosystem II protein M (chloroplast) [Solanum chilense]
ref|YP_009131873.1| photosystem II protein M (chloroplast) [Solanum galapagense]
ref|YP_009132122.1| photosystem II protein M (chloroplast) [Solanum peruvianum]
ref|YP_009132205.1| photosystem II protein M (chloroplast) [Solanum pimpinellifolium]
ref|YP_009132746.1| photosystem II protein M (chloroplast) [Dunalia brachyacantha]
ref|YP_009120911.1| photosystem II protein M (plastid) [Sabal domingensis]
ref|YP_009120997.1| photosystem II protein M (plastid) [Cardamine impatiens]
ref|YP_009121082.1| photosystem II protein M (plastid) [Cardamine resedifolia]
ref|YP_009122858.1| photosystem II protein M (chloroplast) [Capsicum lycianthoides]
ref|YP_009123519.1| photosystem II protein M (plastid) [Physalis peruviana]
ref|YP_009134769.1| photosystem II protein M (plastid) [Bambusa bambos]
ref|YP_009134852.1| photosystem II protein M (plastid) [Bambusa arnhemica]
ref|YP_009134935.1| photosystem II protein M (plastid) [Chusquea spectabilis]
ref|YP_009135018.1| photosystem II protein M (plastid) [Diandrolyra sp. Clark 1301]
ref|YP_009135098.1| photosystem II protein M (plastid) [Greslania sp. McPherson 19217]
ref|YP_009135181.1| photosystem II protein M (plastid) [Hickelia madagascariensis]
ref|YP_009135264.1| photosystem II protein M (plastid) [Neohouzeaua sp. Clark &
Attigala 1712]
ref|YP_009135347.1| photosystem II protein M (plastid) [Neololeba atra]
ref|YP_009135430.1| photosystem II protein M (plastid) [Olmeca reflexa]
ref|YP_009135513.1| photosystem II protein M (plastid) [Raddia brasiliensis]
ref|YP_009135681.1| photosystem II protein M (plastid) [Buergersiochloa bambusoides]
ref|YP_009135764.1| photosystem II protein M (plastid) [Chusquea liebmannii]
ref|YP_009135846.1| photosystem II protein M (plastid) [Lithachne pauciflora]
ref|YP_009135926.1| photosystem II protein M (plastid) [Otatea acuminata]
ref|YP_009136009.1| photosystem II protein M (plastid) [Pariana radiciflora]
ref|YP_009136726.1| photosystem II protein M (plastid) [Guadua weberbaueri]
ref|YP_009139095.1| photosystem II protein M (chloroplast) [Dioscorea zingiberensis]
ref|YP_009139462.1| photosystem II protein M (chloroplast) [Dunalia solanacea]
ref|YP_009139774.1| photosystem II protein M (chloroplast) [Cynara humilis]
ref|YP_009141857.1| photosystem II protein M (chloroplast) [Xerophyllum tenax]
ref|YP_009141944.1| photosystem II protein M (chloroplast) [Heloniopsis tubiflora]
ref|YP_009142044.1| PsbM (chloroplast) [Fagopyrum tataricum]
ref|YP_009142320.1| photosystem II protein M (chloroplast) [Iochroma tingoanum]
ref|YP_009142477.1| photosystem II protein M (chloroplast) [Chikusichloa aquatica]
ref|YP_009145098.1| photosystem II protein M (chloroplast) [Podococcus barteri]
ref|YP_009143883.1| photosystem II protein M (plastid) [Cypripedium japonicum]
ref|YP_009144316.1| photosystem II protein M (plastid) [Carex siderosticta]
ref|YP_009144509.1| PSII M protein (chloroplast) [Salvia rosmarinus]
ref|YP_009144973.1| photosystem II protein M (chloroplast) [Dieffenbachia seguine]
ref|YP_009155529.1| photosystem II protein M (chloroplast) [Oryza barthii]
ref|YP_009155611.1| photosystem II protein M (chloroplast) [Oryza glumipatula]
ref|YP_009155694.1| photosystem II protein M (chloroplast) [Oryza longistaminata]
ref|YP_009155777.1| photosystem II protein M (chloroplast) [Oryza officinalis]
ref|YP_009156194.1| photosystem II protein M (plastid) [Avena sativa]
ref|YP_009156362.1| photosystem II protein M (plastid) [Brachyelytrum aristosum]
ref|YP_009156697.1| photosystem II protein M (plastid) [Diarrhena obovata]
ref|YP_009156946.1| photosystem II protein M (plastid) [Melica mutica]
ref|YP_009157029.1| photosystem II protein M (plastid) [Melica subulata]
ref|YP_009157196.1| photosystem II protein M (plastid) [Phaenosperma globosum]
ref|YP_009157280.1| photosystem II protein M (plastid) [Phalaris arundinacea]
ref|YP_009157891.1| photosystem II protein M (plastid) [Chusquea circinata]
ref|YP_009157975.1| photosystem II protein M (plastid) [Pariana campestris]
ref|YP_009154772.1| photosystem II protein M (chloroplast) [Aster spathulifolius]
ref|YP_009159820.1| photosystem II protein M (chloroplast) [Carnegiea gigantea]
ref|YP_009162255.1| photosystem II M protein (chloroplast) [Scutellaria baicalensis]
ref|YP_009161178.1| PsbM (chloroplast) [Oryza punctata]
ref|YP_009161548.1| photosystem II protein M (chloroplast) [Pinellia ternata]
ref|YP_009161915.1| photosystem II protein M (chloroplast) [Capsella rubella]
ref|YP_009162871.1| photosystem II protein M (chloroplast) [Rheum palmatum]
ref|YP_009164575.1| photosystem II protein M (chloroplast) [Lathraea squamaria]
ref|YP_009166599.1| photosystem II protein M (chloroplast) [Epipremnum aureum]
ref|YP_009166685.1| photosystem II protein M (chloroplast) [Tanaecium tetragonolobum]
ref|YP_009169350.1| photosystem II protein M (chloroplast) [Clematis terniflora]
ref|YP_009169480.1| photosystem II protein M (chloroplast) [Cynara baetica]
ref|YP_009169567.1| photosystem II protein M (chloroplast) [Cynara cornigera]
ref|YP_009169662.1| PsbM (chloroplast) [Capsicum frutescens]
ref|YP_009170171.1| photosystem II protein M (plastid) [Colpothrinax cookii]
ref|YP_009171776.1| PsbM (chloroplast) [Solanum commersonii]
ref|YP_009171862.1| PsbM (chloroplast) [Solanum nigrum]
ref|YP_009172271.1| photosystem II protein M (chloroplast) [Colobanthus quitensis]
ref|YP_009175267.1| photosystem II protein M (chloroplast) [Phragmipedium longifolium]
ref|YP_009178652.1| photosystem II protein M (chloroplast) [Pseudosasa japonica]
ref|YP_009179050.1| photosystem II protein M (chloroplast) [Ostrya rehderiana]
ref|YP_009179946.1| photosystem II protein M (chloroplast) [Bletilla striata]
ref|YP_009180365.1| photosystem II protein M (chloroplast) [Musa balbisiana]
ref|YP_009182885.1| photosystem II protein M (chloroplast) [Capsella grandiflora]
ref|YP_009182983.1| photosystem II protein M (plastid) [Plantago maritima]
ref|YP_009183073.1| photosystem II protein M (plastid) [Plantago media]
ref|YP_009183586.1| photosystem II protein M (chloroplast) [Scutellaria insignis]
ref|YP_009184048.1| photosystem II protein M (chloroplast) [Dendrobium chrysotoxum]
ref|YP_009186480.1| photosystem II protein M (plastid) [Otatea glauca]
ref|YP_009192956.1| photosystem II protein M (chloroplast) [Curcuma flaviflora]
ref|YP_009228758.1| photosystem II protein M (chloroplast) [Metanarthecium luteoviride]
ref|YP_009229201.1| photosystem II protein M (chloroplast) [Guadua chacoensis]
ref|YP_009229375.1| photosystem II protein M (chloroplast) [Syagrus coronata]
ref|YP_009231069.1| photosystem II protein M (chloroplast) [Camelina sativa]
ref|YP_009234380.1| photosystem II protein M (chloroplast) [Akebia trifoliata]
ref|YP_009234549.1| photosystem II protein M (chloroplast) [Euptelea pleiosperma]
ref|YP_009234634.1| photosystem II protein M (chloroplast) [Meliosma aff. cuneifolia
Moore 333]
ref|YP_009234803.1| photosystem II protein M (chloroplast) [Stephania japonica]
ref|YP_009234888.1| photosystem II protein M (chloroplast) [Pachysandra terminalis]
ref|YP_009236490.1| photosystem II protein M (chloroplast) [Quercus baronii]
ref|YP_009239071.1| photosystem II protein M (chloroplast) [Monsonia emarginata]
ref|YP_009240593.1| photosystem II protein M (chloroplast) [Iochroma cardenasianum]
ref|YP_009240697.1| photosystem II protein M (chloroplast) [Guadua angustifolia]
ref|YP_009240788.1| PSII M protein (chloroplast) [Diplopanax stachyanthus]
ref|YP_009241301.1| psbM (chloroplast) [Drosera rotundifolia]
ref|YP_009241740.1| photosystem II protein M (plastid) [Tofieldia thibetica]
ref|YP_009241825.1| photosystem II protein M (plastid) [Potamogeton perfoliatus]
ref|YP_009241910.1| photosystem II protein M (plastid) [Sagittaria lichuanensis]
ref|YP_009242057.1| photosystem II protein M (chloroplast) [Stenogyne haliakalae]
ref|YP_009242145.1| photosystem II protein M (chloroplast) [Stenogyne bifida]
ref|YP_009242233.1| photosystem II protein M (chloroplast) [Haplostachys haplostachya]
ref|YP_009242321.1| photosystem II protein M (chloroplast) [Phyllostegia velutina]
ref|YP_009242409.1| photosystem II protein M (chloroplast) [Stenogyne kanehoana]
ref|YP_009242497.1| photosystem II protein M (chloroplast) [Stachys chamissonis]
ref|YP_009242585.1| photosystem II protein M (chloroplast) [Stachys coccinea]
ref|YP_009242673.1| photosystem II protein M (chloroplast) [Stachys sylvatica]
ref|YP_009242761.1| photosystem II protein M (chloroplast) [Stachys byzantina]
ref|YP_009243024.1| photosystem II M protein (chloroplast) [Aconitum chiisanense]
ref|YP_009243210.1| photosystem II protein M (chloroplast) [Iochroma australe]
ref|YP_009245004.1| photosystem II M protein (chloroplast) [Kolkwitzia amabilis]
ref|YP_009247060.1| photosystem II protein M (chloroplast) [Mauritia flexuosa]
ref|YP_009247146.1| photosystem II protein M (plastid) [Caryota mitis]
ref|YP_009247232.1| photosystem II protein M (plastid) [Wallichia densiflora]
ref|YP_009247317.1| photosystem II protein M (plastid) [Veitchia arecina]
ref|YP_009247403.1| photosystem II protein M (plastid) [Trithrinax brasiliensis]
ref|YP_009247489.1| photosystem II protein M (plastid) [Tahina spectabilis]
ref|YP_009247569.1| photosystem II protein M (plastid) [Serenoa repens]
ref|YP_009247741.1| photosystem II protein M (plastid) [Pritchardia thurstonii]
ref|YP_009247827.1| photosystem II protein M (plastid) [Pigafetta elata]
ref|YP_009247914.1| photosystem II protein M (plastid) [Phytelephas aequatorialis]
ref|YP_009248000.1| photosystem II protein M (plastid) [Nypa fruticans]
ref|YP_009248086.1| photosystem II protein M (plastid) [Metroxylon warburgii]
ref|YP_009248172.1| photosystem II protein M (plastid) [Lodoicea maldivica]
ref|YP_009248258.1| photosystem II protein M (plastid) [Leucothrinax morrisii]
ref|YP_009248344.1| photosystem II protein M (plastid) [Hanguana malayana]
ref|YP_009248430.1| photosystem II protein M (plastid) [Eugeissona tristis]
ref|YP_009248512.1| photosystem II protein M (plastid) [Eremospatha macrocarpa]
ref|YP_009248598.1| photosystem II protein M (plastid) [Corypha lecomtei]
ref|YP_009248684.1| photosystem II protein M (plastid) [Chuniophoenix nana]
ref|YP_009248770.1| photosystem II protein M (plastid) [Chamaerops humilis]
ref|YP_009248856.1| photosystem II protein M (plastid) [Brahea brandegeei]
ref|YP_009248942.1| photosystem II protein M (plastid) [Borassodendron machadonis]
ref|YP_009249028.1| photosystem II protein M (plastid) [Baxteria australis]
ref|YP_009249114.1| photosystem II protein M (plastid) [Arenga caudata]
ref|YP_009249200.1| photosystem II protein M (plastid) [Areca vestiaria]
ref|YP_009249279.1| photosystem II protein M (plastid) [Acoelorraphe wrightii]
ref|YP_009249365.1| photosystem II protein M (plastid) [Washingtonia robusta]
ref|YP_009250859.1| photosystem II protein M (chloroplast) [Iochroma umbellatum]
ref|YP_009250976.1| photosystem II protein M (plastid) [Geranium incanum]
ref|YP_009251230.1| photosystem II protein M (chloroplast) [Acnistus arborescens x
Iochroma cyaneum]
ref|YP_009251638.1| photosystem II protein M (chloroplast) [Colchicum autumnale]
ref|YP_009251724.1| photosystem II protein M (chloroplast) [Gloriosa superba]
ref|YP_009252484.1| photosystem II protein M (plastid) [Annona cherimola]
ref|YP_009252586.1| photosystem II protein M (chloroplast) [Iochroma lehmannii]
ref|YP_009252669.1| photosystem II protein M (chloroplast) [Iochroma salpoanum]
ref|YP_009252842.1| photosystem II protein M (chloroplast) [Eriolarynx fasciculata]
ref|YP_009252935.1| photosystem II protein M (chloroplast) [Helianthus debilis]
ref|YP_009253067.1| photosystem II protein M (chloroplast) [Iochroma ellipticum]
ref|YP_009253151.1| photosystem II protein M (chloroplast) [Iochroma cyaneum]
ref|YP_009253244.1| photosystem II protein M (chloroplast) [Bruinsmia polysperma]
ref|YP_009253382.1| photosystem II protein M (chloroplast) [Acnistus arborescens]
ref|YP_009254072.1| PsbM (plastid) [Solanum melongena]
ref|YP_009254209.1| photosystem II protein M (chloroplast) [Erythranthe lutea]
ref|YP_009255600.1| PSII M protein (chloroplast) [Cornus controversa]
ref|YP_009255861.1| photosystem II protein M (chloroplast) [Helianthus argophyllus]
ref|YP_009256028.1| photosystem II protein M (chloroplast) [Scopolia parviflora]
ref|YP_009256227.1| photosystem II protein M (chloroplast) [Oryza minuta]
ref|YP_009258162.1| PSII low MW protein (chloroplast) [Arabidopsis suecica]
ref|YP_009261474.1| photosystem II protein M (chloroplast) [Liriodendron chinense]
ref|YP_009266410.1| photosystem II protein M (chloroplast) [Oryza brachyantha]
ref|YP_009262857.1| PsbM (chloroplast) [Capsicum chinense]
ref|YP_009269555.1| photosystem II protein M (chloroplast) [Cephalanthera longifolia]
ref|YP_009270039.1| photosystem II protein M (chloroplast) [Listera fugongensis]
ref|YP_009269641.1| photosystem II protein M (chloroplast) [Epipactis mairei]
ref|YP_009269838.1| photosystem II protein M (chloroplast) [Epipactis veratrifolia]
ref|YP_009269954.1| photosystem II protein M (chloroplast) [Neottia pinetorum]
ref|YP_009270125.1| photosystem II protein M (chloroplast) [Neottia ovata]
ref|YP_009270906.1| PsbM (chloroplast) [Perilla setoyensis]
ref|YP_009271290.1| photosystem II protein M (chloroplast) [Amaranthus hypochondriacus]
ref|YP_009272242.1| photosystem II protein M (chloroplast) [Diospyros oleifera]
ref|YP_009272342.1| photosystem II protein M (chloroplast) [Diospyros kaki]
ref|YP_009270730.1| PsbM (chloroplast) [Perilla citriodora]
ref|YP_009270818.1| PsbM (chloroplast) [Perilla frutescens]
ref|YP_009271032.1| photosystem II M protein (chloroplast) [Aconitum carmichaelii]
ref|YP_009271176.1| photosystem II protein M (chloroplast) [Ampelocalamus naibunensis]
ref|YP_009271455.1| PsbM (chloroplast) [Eclipta prostrata]
ref|YP_009271892.1| PsbM (chloroplast) [Carthamus tinctorius]
ref|YP_009271984.1| photosystem II protein M (chloroplast) [Diospyros glaucifolia]
ref|YP_009272155.1| photosystem II protein M (chloroplast) [Diospyros lotus]
ref|YP_009272489.1| photosystem II protein M (chloroplast) [Utricularia reniformis]
ref|YP_009294857.1| photosystem II protein M (plastid) [Veronica nakaiana]
ref|YP_009298354.1| photosystem II protein M (chloroplast) [Actinidia polygama]
ref|YP_009298437.1| photosystem II protein M (chloroplast) [Actinidia tetramera]
ref|YP_009305292.1| PsbM (chloroplast) [Oryza sativa]
ref|YP_009295098.1| photosystem II protein M (chloroplast) [Ipomoea nil]
ref|YP_009305543.1| photosystem II protein M (plastid) [Veronica persica]
ref|YP_009305629.1| photosystem II protein M (plastid) [Veronicastrum sibiricum]
ref|YP_009305909.1| photosystem II protein M (chloroplast) [Quercus variabilis]
ref|YP_009305995.1| photosystem II protein M (chloroplast) [Quercus dolicholepis]
ref|YP_009306464.1| photosystem II protein M (chloroplast) [Helwingia himalaica]
ref|YP_009306771.1| photosystem II protein M (chloroplast) [Davidia involucrata]
ref|YP_009308072.1| photosystem II M protein (chloroplast) [Aconitum austrokoreense]
ref|YP_009308469.1| photosystem II proteinM (chloroplast) [Aconitum ciliare]
ref|YP_009308555.1| photosystem II proteinM (chloroplast) [Aconitum coreanum]
ref|YP_009308640.1| photosystem II proteinM (chloroplast) [Aconitum kusnezoffii]
ref|YP_009308725.1| photosystem II proteinM (chloroplast) [Aconitum monanthum]
ref|YP_009308997.1| photosystem II protein M (chloroplast) [Joinvillea ascendens]
ref|YP_009309271.1| PSII M protein (chloroplast) [Pogostemon yatabeanus]
ref|YP_009309358.1| PSII M protein (chloroplast) [Pogostemon stellatus]
ref|YP_009309445.1| PSII M protein (chloroplast) [Paulownia coreana]
ref|YP_009309532.1| PSII M protein (chloroplast) [Paulownia tomentosa]
ref|YP_009309868.1| PSII M protein (chloroplast) [Abeliophyllum distichum]
ref|YP_009309955.1| PSII low MW protein M (chloroplast) [Coreanomecon hylomeconoides]
ref|YP_009310512.1| photosystem II protein M (chloroplast) [Cabomba caroliniana]
ref|YP_009312609.1| PsbM (chloroplast) [Avena sterilis]
ref|YP_009312697.1| photosystem II protein M (chloroplast) [Ranunculus occidentalis]
ref|YP_009317903.1| photosystem II protein M (chloroplast) [Haberlea rhodopensis]
ref|YP_009316307.1| photosystem II protein M (plastid) [Castilleja paramensis]
ref|YP_009316972.1| photosystem II protein M (chloroplast) [Nymphaea jamesoniana]
ref|YP_009317286.1| photosystem II protein M (chloroplast) [Mikania micrantha]
ref|YP_009317793.1| photosystem II protein M (chloroplast) [Trollius chinensis]
ref|YP_009318533.1| photosystem II protein M (chloroplast) [Dracocephalum palmatum]
ref|YP_009319989.1| photosystem II protein M (plastid) [Alniphyllum eberhardtii]
ref|YP_009317982.1| photosystem II protein M (chloroplast) [Galinsoga quadriradiata]
ref|YP_009327381.1| photosystem II M protein (chloroplast) [Mentha longifolia]
ref|YP_009334399.1| photosystem II protein M (chloroplast) [Albuca kirkii]
ref|YP_009336371.1| photosystem II protein M (chloroplast) [Nicotiana otophora]
ref|YP_009338155.1| photosystem II M protein (chloroplast) [Gymnaconitum gymnandrum]
ref|YP_009338624.1| PSII low MW protein M (chloroplast) [Averrhoa carambola]
ref|YP_009338746.1| PSII low MW protein M (chloroplast) [Carissa macrocarpa]
ref|YP_009341867.1| photosystem II protein M (chloroplast) [Aletris spicata]
ref|YP_009341952.1| photosystem II protein M (chloroplast) [Aletris fauriei]
ref|YP_009344244.1| PsbM (chloroplast) [Capsicum eximium]
ref|YP_009342756.1| PSII low MW protein M (chloroplast) [Pouteria campechiana]
ref|YP_009342841.1| PSII low MW protein M (chloroplast) [Diospyros blancoi]
ref|YP_009343983.1| PsbM (chloroplast) [Capsicum galapagoense]
ref|YP_009344070.1| PsbM (chloroplast) [Capsicum chacoense]
ref|YP_009344157.1| PsbM (chloroplast) [Capsicum tovarii]
ref|YP_009344430.1| PSII M protein (chloroplast) [Rehmannia chingii]
ref|YP_009342926.1| photosystem II protein M (chloroplast) [Carpinus putoensis]
ref|YP_009349516.1| photosystem II protein M (chloroplast) [Betula nana]
ref|YP_009346251.1| photosystem II protein M (chloroplast) [Leptaspis banksii]
ref|YP_009346326.1| photosystem II protein M (chloroplast) [Leptaspis zeylanica]
ref|YP_009347230.1| photosystem II protein M (chloroplast) [Castanea henryi]
ref|YP_009348457.1| photosystem II protein M (chloroplast) [Akebia quinata]
ref|YP_009349268.1| photosystem II protein M (chloroplast) [Symplocarpus renifolius]
ref|YP_009346168.1| photosystem II protein M (chloroplast) [Streptochaeta spicata]
ref|YP_009354872.1| photosystem II protein M (plastid) [Echinacea angustifolia]
ref|YP_009353622.1| photosystem II protein M (chloroplast) [Ostrya trichocarpa]
ref|YP_009353936.1| PSII M protein (chloroplast) [Rehmannia glutinosa]
ref|YP_009354024.1| PSII M protein (chloroplast) [Rehmannia henryi]
ref|YP_009354111.1| PSII M protein (chloroplast) [Rehmannia solanifolia]
ref|YP_009354199.1| PSII M protein (chloroplast) [Rehmannia piasezkii]
ref|YP_009354286.1| PSII M protein (chloroplast) [Rehmannia elata]
ref|YP_009354617.1| photosystem II protein M (plastid) [Echinacea pallida]
ref|YP_009354702.1| photosystem II protein M (plastid) [Echinacea laevigata]
ref|YP_009354787.1| photosystem II protein M (plastid) [Echinacea atrorubens]
ref|YP_009354957.1| photosystem II protein M (plastid) [Echinacea speciosa]
ref|YP_009355042.1| photosystem II protein M (plastid) [Echinacea tennesseensis]
ref|YP_009355127.1| photosystem II protein M (plastid) [Echinacea purpurea]
ref|YP_009355212.1| photosystem II protein M (plastid) [Echinacea sanguinea]
ref|YP_009356434.1| PSII low MW protein (chloroplast) [Lepidium meyenii]
ref|YP_009356521.1| photosystem II protein M (chloroplast) [Tarenaya hassleriana]
ref|YP_009354532.1| photosystem II protein M (plastid) [Echinacea paradoxa]
ref|YP_009364387.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
ref|YP_009364664.1| photosystem II protein M (plastid) [Ipomoea trifida]
ref|YP_009369202.1| photosystem II protein M (chloroplast) [Oryza latifolia]
ref|YP_009369289.1| photosystem II protein M (chloroplast) [Oryza longiglumis]
ref|YP_009369376.1| photosystem II protein M (chloroplast) [Oryza ridleyi]
ref|YP_009369549.1| photosystem II protein M (chloroplast) [Leersia japonica]
ref|YP_009368854.1| photosystem II protein M (chloroplast) [Oryza rhizomatis]
ref|YP_009368941.1| photosystem II protein M (chloroplast) [Oryza eichingeri]
ref|YP_009369463.1| photosystem II protein M (chloroplast) [Oryza meyeriana]
ref|YP_009365570.1| PsbM (plastid) [Magnolia biondii]
ref|YP_009366165.1| photosystem II protein M (plastid) [Jasminum sambac]
ref|YP_009366079.1| photosystem II M protein (plastid) [Scutellaria lateriflora]
ref|YP_009366916.1| photosystem II protein M (plastid) [Illicium anisatum]
ref|YP_009365442.1| photosystem II protein M (plastid) [Illicium floridanum]
ref|YP_009365485.1| photosystem II protein M (plastid) [Dioscorea villosa]
ref|YP_009365654.1| photosystem II protein M (plastid) [Digitalis lanata]
ref|YP_009365737.1| photosystem II protein M (plastid) [Illicium verum]
ref|YP_009365911.1| photosystem II protein M (plastid) [Jasminum tortuosum]
ref|YP_009366590.1| photosystem II protein M (plastid) [Illicium henryi]
ref|YP_009366834.1| photosystem II protein M (plastid) [Hydrastis canadensis]
ref|YP_009372216.1| PsbM (chloroplast) [Diplostephium huertasii]
ref|YP_009372471.1| PsbM (chloroplast) [Diplostephium obtusum]
ref|YP_009371876.1| PsbM (chloroplast) [Diplostephium violaceum]
ref|YP_009371961.1| PsbM (chloroplast) [Diplostephium oblongifolium]
ref|YP_009371791.1| PsbM (chloroplast) [Diplostephium rhododendroides]
ref|YP_009372046.1| PsbM (chloroplast) [Llerasia caucana]
ref|YP_009372131.1| PsbM (chloroplast) [Diplostephium juajibioyi]
ref|YP_009372386.1| PsbM (chloroplast) [Diplostephium meyenii]
ref|YP_009372556.1| PsbM (chloroplast) [Diplostephium tachirense]
ref|YP_009372641.1| PsbM (chloroplast) [Diplostephium serratifolium]
ref|YP_009372726.1| PsbM (chloroplast) [Diplostephium mutiscuanum]
ref|YP_009372896.1| PsbM (chloroplast) [Diplostephium jenesanum]
ref|YP_009373477.1| PsbM (chloroplast) [Diplostephium alveolatum]
ref|YP_009373562.1| PsbM (chloroplast) [Archibaccharis asperifolia]
ref|YP_009373647.1| PsbM (chloroplast) [Oritrophium peruvianum]
ref|YP_009374156.1| PsbM (chloroplast) [Heterothalamus alienus]
ref|YP_009374411.1| PsbM (chloroplast) [Laestadia muscicola]
ref|YP_009374496.1| PsbM (chloroplast) [Diplostephium rhomboidale]
ref|YP_009376621.1| PsbM (chloroplast) [Hinterhubera ericoides]
ref|YP_009377131.1| PsbM (chloroplast) [Parastrephia quadrangularis]
ref|YP_009377471.1| PsbM (chloroplast) [Diplostephium jaramilloi]
ref|YP_009377641.1| PsbM (chloroplast) [Diplostephium heterophyllum]
ref|YP_009377726.1| PsbM (chloroplast) [Diplostephium camargoanum]
ref|YP_009378236.1| PsbM (chloroplast) [Diplostephium ochraceum]
ref|YP_009380292.1| PsbM (chloroplast) [Solanum berthaultii]
ref|YP_009373902.1| PsbM (chloroplast) [Baccharis genistelloides]
ref|YP_009374581.1| PsbM (chloroplast) [Diplostephium tenuifolium]
ref|YP_009374666.1| PsbM (chloroplast) [Diplostephium colombianum]
ref|YP_009374836.1| PsbM (chloroplast) [Diplostephium revolutum]
ref|YP_009374921.1| PsbM (chloroplast) [Exostigma notobellidiastrum]
ref|YP_009375006.1| PsbM (chloroplast) [Diplostephium rupestre]
ref|YP_009375091.1| PsbM (chloroplast) [Blakiella bartsiifolia]
ref|YP_009375261.1| PsbM (chloroplast) [Baccharis tricuneata]
ref|YP_009375346.1| PsbM (chloroplast) [Diplostephium cinereum]
ref|YP_009375771.1| PsbM (chloroplast) [Diplostephium eriophorum]
ref|YP_009375856.1| PsbM (chloroplast) [Diplostephium glutinosum]
ref|YP_009375941.1| PsbM (chloroplast) [Diplostephium antioquense]
ref|YP_009376026.1| PsbM (chloroplast) [Laennecia sophiifolia]
ref|YP_009376196.1| PsbM (chloroplast) [Diplostephium costaricense]
ref|YP_009376366.1| PsbM (chloroplast) [Diplostephium crypteriophyllum]
ref|YP_009376706.1| PsbM (chloroplast) [Diplostephium romeroi]
ref|YP_009376876.1| PsbM (chloroplast) [Diplostephium venezuelense]
ref|YP_009377046.1| PsbM (chloroplast) [Westoniella kohkemperi]
ref|YP_009377301.1| PsbM (chloroplast) [Diplostephium schultzii]
ref|YP_009377386.1| PsbM (chloroplast) [Diplostephium frontinense]
ref|YP_009377556.1| PsbM (chloroplast) [Diplostephium inesianum]
ref|YP_009377811.1| PsbM (chloroplast) [Aztecaster matudae]
ref|YP_009377896.1| PsbM (chloroplast) [Diplostephium coriaceum]
ref|YP_009377981.1| PsbM (chloroplast) [Diplostephium rosmarinifolium]
ref|YP_009378151.1| PsbM (chloroplast) [Diplostephium apiculatum]
ref|YP_009378408.1| photosystem II protein M (chloroplast) [Schisandra chinensis]
ref|YP_009378670.1| photosystem II protein M (chloroplast) [Actinidia arguta]
ref|YP_009378754.1| photosystem II protein M (chloroplast) [Actinidia eriantha]
ref|YP_009378838.1| photosystem II protein M (chloroplast) [Actinidia kolomikta]
ref|YP_009380124.1| PsbM (chloroplast) [Chenopodium quinoa]
ref|YP_009380208.1| PsbM (chloroplast) [Chenopodium album]
ref|YP_009383722.1| photosystem II protein M (chloroplast) [Chionanthus retusus]
ref|YP_009383522.1| photosystem II protein M (chloroplast) [Aster altaicus]
ref|YP_009383871.1| photosystem II protein M (chloroplast) [Morella rubra]
ref|YP_009388654.1| photosystem II protein M (chloroplast) [Cistanthe longiscapa]
ref|YP_009388764.1| photosystem II protein M (chloroplast) [Ocimum basilicum]
ref|YP_009389670.1| photosystem II protein M (chloroplast) [Lychnis wilfordii]
ref|YP_009389753.1| photosystem II protein M (chloroplast) [Silene capitata]
ref|YP_009390212.1| photosystem II M protein (chloroplast) [Salvia japonica]
ref|YP_009401387.1| photosystem II protein M (chloroplast) [Dendrobium salaccense]
ref|YP_009407324.1| photosystem II protein M (chloroplast) [Aldrovanda vesiculosa]
ref|YP_009407392.1| photosystem II protein M (chloroplast) [Dionaea muscipula]
ref|YP_009407474.1| photosystem II protein M (chloroplast) [Sinojackia xylocarpa]
ref|YP_009411893.1| photosystem II protein M (plastid) [Schima multibracteata]
ref|YP_009413422.1| photosystem II protein M (chloroplast) [Camellia azalea]
ref|YP_009408866.1| photosystem II protein M (chloroplast) [Zantedeschia aethiopica]
ref|YP_009411545.1| photosystem II protein M (plastid) [Schima argentea]
ref|YP_009411632.1| photosystem II protein M (plastid) [Schima brevipedicellata]
ref|YP_009411719.1| photosystem II protein M (plastid) [Schima crenata]
ref|YP_009411806.1| photosystem II protein M (plastid) [Schima khasiana]
ref|YP_009411980.1| photosystem II protein M (plastid) [Schima noronhae]
ref|YP_009412067.1| photosystem II protein M (plastid) [Schima remotiserrata]
ref|YP_009412154.1| photosystem II protein M (plastid) [Schima sericans]
ref|YP_009412241.1| photosystem II protein M (plastid) [Schima sinensis]
ref|YP_009412328.1| photosystem II protein M (plastid) [Schima superba]
ref|YP_009412415.1| photosystem II protein M (plastid) [Schima wallichii]
ref|YP_009414981.1| photosystem II protein M (chloroplast) [Victoria cruziana]
ref|YP_009415066.1| photosystem II protein M (chloroplast) [Barclaya longifolia]
ref|YP_009415212.1| photosystem II protein M (chloroplast) [Musella lasiocarpa]
ref|YP_009415312.1| photosystem II protein M (plastid) [Pyrenaria menglaensis]
ref|YP_009415399.1| photosystem II protein M (plastid) [Stewartia sinensis]
ref|YP_009415486.1| photosystem II protein M (plastid) [Apterosperma oblata]
ref|YP_009415573.1| photosystem II protein M (plastid) [Pyrenaria pingpienensis]
ref|YP_009415660.1| photosystem II protein M (plastid) [Polyspora speciosa]
ref|YP_009415747.1| photosystem II protein M (plastid) [Pyrenaria khasiana]
ref|YP_009415834.1| photosystem II protein M (plastid) [Polyspora axillaris]
ref|YP_009415921.1| photosystem II protein M (plastid) [Gordonia brandegeei]
ref|YP_009416008.1| photosystem II protein M (plastid) [Stewartia crassifolia]
ref|YP_009416095.1| photosystem II protein M (plastid) [Polyspora dalgleishiana]
ref|YP_009416182.1| photosystem II protein M (plastid) [Stewartia cordifolia]
ref|YP_009416269.1| photosystem II protein M (plastid) [Stewartia rubiginosa]
ref|YP_009416356.1| photosystem II protein M (plastid) [Camellia szechuanensis]
ref|YP_009416443.1| photosystem II protein M (plastid) [Camellia elongata]
ref|YP_009416530.1| photosystem II protein M (plastid) [Adinandra angustifolia]
ref|YP_009416617.1| photosystem II protein M (plastid) [Diospyros strigosa]
ref|YP_009416730.1| photosystem II protein M (chloroplast) [Magnolia insignis]
ref|YP_009418092.1| photosystem II protein M (plastid) [Stewartia malacodendron]
ref|YP_009418788.1| photosystem II protein M (plastid) [Gordonia lasianthus]
ref|YP_009419310.1| photosystem II protein M (plastid) [Barringtonia racemosa]
ref|YP_009419919.1| photosystem II protein M (plastid) [Melliodendron xylocarpum]
ref|YP_009417337.1| photosystem II protein M (plastid) [Adinandra millettii]
ref|YP_009417437.1| photosystem II protein M (chloroplast) [Nymphaea ampla]
ref|YP_009417657.1| photosystem II protein M (plastid) [Pyrenaria microcarpa]
ref|YP_009417744.1| photosystem II protein M (plastid) [Tutcheria championii]
ref|YP_009417831.1| photosystem II protein M (plastid) [Camellia mairei]
ref|YP_009417918.1| photosystem II protein M (plastid) [Polyspora longicarpa]
ref|YP_009418005.1| photosystem II protein M (plastid) [Stewartia pteropetiolata]
ref|YP_009418179.1| photosystem II protein M (plastid) [Franklinia alatamaha]
ref|YP_009418266.1| photosystem II protein M (plastid) [Polyspora hainanensis]
ref|YP_009418353.1| photosystem II protein M (plastid) [Pyrenaria oblongicarpa]
ref|YP_009418440.1| photosystem II protein M (plastid) [Stewartia ovata]
ref|YP_009418527.1| photosystem II protein M (plastid) [Stewartia calcicola]
ref|YP_009418614.1| photosystem II protein M (plastid) [Stewartia pseudocamellia]
ref|YP_009418701.1| photosystem II protein M (plastid) [Stewartia rostrata]
ref|YP_009418875.1| photosystem II protein M (plastid) [Gordonia fruticosa]
ref|YP_009418962.1| photosystem II protein M (plastid) [Barringtonia fusicarpa]
ref|YP_009419049.1| photosystem II protein M (plastid) [Symplocos paniculata]
ref|YP_009419136.1| photosystem II protein M (plastid) [Diospyros dumetorum]
ref|YP_009419223.1| photosystem II protein M (plastid) [Pyrenaria diospyricarpa]
ref|YP_009419397.1| photosystem II protein M (plastid) [Ternstroemia gymnanthera]
ref|YP_009419484.1| photosystem II protein M (plastid) [Sladenia celastrifolia]
ref|YP_009419571.1| photosystem II protein M (plastid) [Symplocos costaricana]
ref|YP_009419658.1| photosystem II protein M (plastid) [Anneslea fragrans]
ref|YP_009419832.1| photosystem II protein M (plastid) [Sinojackia rehderiana]
ref|YP_009420567.1| photosystem II protein M (chloroplast) [Musa itinerans]
ref|YP_009420655.1| photosystem II protein M (chloroplast) [Solanum dulcamara]
ref|YP_009420888.1| photosystem II protein M (chloroplast) [Caryopteris mongholica]
ref|YP_009421351.1| photosystem II protein M (chloroplast) [Solanum pennellii]
ref|YP_009428455.1| photosystem II protein M (chloroplast) [Conyza bonariensis]
ref|YP_009424557.1| PSII low MW protein M (chloroplast) [Pelatantheria
scolopendrifolia]
ref|YP_009424631.1| PSII low MW protein M (chloroplast) [Gastrochilus fuscopunctatus]
ref|YP_009424705.1| PSII low MW protein M (chloroplast) [Thrixspermum japonicum]
ref|YP_009424852.1| PSII low MW protein M (chloroplast) [Gastrochilus japonicus]
ref|YP_009427977.1| photosystem II protein M (chloroplast) [Ambrosia artemisiifolia]
ref|YP_009428072.1| PSII M protein (chloroplast) [Echinacanthus lofouensis]
ref|YP_009428701.1| PsbM (chloroplast) [Aconitum pseudolaeve]
ref|YP_009428614.1| PsbM (chloroplast) [Aconitum longecassidatum]
ref|YP_009428972.1| photosystem II protein M (chloroplast) [Alpinia oxyphylla]
ref|YP_009428789.1| photosystem II protein M (chloroplast) [Decaisnea insignis]
ref|YP_009429347.1| photosystem II protein M (plastid) [Rheum wittrockii]
ref|YP_009429444.1| photosystem II protein M (chloroplast) [Nicotiana attenuata]
ref|YP_009429795.1| photosystem II protein M (chloroplast) [Magnolia laevifolia]
ref|YP_009433185.1| photosystem II protein M (chloroplast) [Pedicularis
cheilanthifolia]
ref|YP_009433798.1| PSII M protein (chloroplast) [Hypolytrum nemorum]
ref|YP_009433879.1| PSII M protein (chloroplast) [Carex neurocarpa]
ref|YP_009434242.1| photosystem II protein M (chloroplast) [Camptotheca acuminata]
ref|YP_009434673.1| photosystem II protein M (chloroplast) [Sinowilsonia henryi]
ref|YP_009437462.1| photosystem II protein M (chloroplast) [Primulina eburnea]
ref|YP_009437550.1| photosystem II protein M (chloroplast) [Primulina liboensis]
ref|YP_009440667.1| photosystem II protein M (chloroplast) [Aristolochia contorta]
ref|YP_009440752.1| photosystem II protein M (chloroplast) [Aristolochia debilis]
ref|YP_009440837.1| photosystem II protein M (plastid) [Japonolirion osense]
ref|YP_009441434.1| photosystem II protein M (chloroplast) [Portulaca oleracea]
ref|YP_009443139.1| photosystem II protein M (chloroplast) [Pleione bulbocodioides]
ref|YP_009443313.1| photosystem II protein M (chloroplast) [Littledalea racemosa]
ref|YP_009443603.1| photosystem II M protein (chloroplast) [Aconitum angustius]
ref|YP_009443685.1| photosystem II M protein (chloroplast) [Aconitum finetianum]
ref|YP_009443767.1| photosystem II M protein (chloroplast) [Aconitum sinomontanum]
ref|YP_009443941.1| photosystem II protein M (chloroplast) [Forsythia suspensa]
ref|YP_009444124.1| photosystem II protein M (chloroplast) [Quercus tarokoensis]
ref|YP_009445146.1| photosystem II protein M (chloroplast) [Bertholletia excelsa]
ref|YP_009445238.1| photosystem II protein M (chloroplast) [Primulina huaijiensis]
ref|YP_009445325.1| photosystem II protein M (chloroplast) [Primulina linearifolia]
ref|YP_009445754.1| photosystem II protein M (chloroplast) [Colobanthus apetalus]
ref|YP_009444296.1| PSII low MW protein M (chloroplast) [Neofinetia falcata]
ref|YP_009444370.1| PSII low MW protein M (chloroplast) [Neofinetia richardsiana]
ref|YP_009446599.1| photosystem II protein M (chloroplast) [Adenocalymma aurantiacum]
ref|YP_009446853.1| photosystem II protein M (chloroplast) [Adenocalymma cristicalyx]
ref|YP_009446257.1| photosystem II protein M (chloroplast) [Symplocos ovatilobata]
ref|YP_009446337.1| photosystem II protein M (chloroplast) [Saussurea polylepis]
ref|YP_009446514.1| photosystem II protein M (chloroplast) [Adenocalymma
allamandiflorum]
ref|YP_009446684.1| photosystem II protein M (chloroplast) [Adenocalymma biternatum]
ref|YP_009446768.1| photosystem II protein M (chloroplast) [Adenocalymma bracteatum]
ref|YP_009446938.1| photosystem II protein M (chloroplast) [Adenocalymma hatschbachii]
ref|YP_009447023.1| photosystem II protein M (chloroplast) [Adenocalymma pedunculatum]
ref|YP_009447109.1| photosystem II protein M (chloroplast) [Adenocalymma peregrinum]
ref|YP_009447192.1| photosystem II protein M (chloroplast) [Adenocalymma subspicatum]
ref|YP_009447276.1| photosystem II protein M (chloroplast) [Neojobertia candolleana]
ref|YP_009447354.1| photosystem II protein M (chloroplast) [Achyrachaena mollis]
ref|YP_009450368.1| photosystem II reaction center M protein (chloroplast) [Saussurea
chabyoungsanica]
ref|YP_009450666.1| photosystem II protein M (chloroplast) [Streptogyna americana]
ref|YP_009451340.1| photosystem II protein M (chloroplast) [Humbertochloa
bambusiuscula]
ref|YP_009451926.1| PsbM (chloroplast) [Phyllorachis sagittata]
ref|YP_009452097.1| photosystem II protein M (chloroplast) [Rhipidocladum pittieri]
ref|YP_009453684.1| photosystem II protein M (chloroplast) [Carpinus cordata]
ref|YP_009453886.1| photosystem II protein M (chloroplast) [Przewalskia tangutica]
ref|YP_009454626.1| photosystem II protein M (chloroplast) [Alnus cordata]
ref|YP_009454711.1| photosystem II protein M (chloroplast) [Alnus incana]
ref|YP_009454796.1| photosystem II protein M (chloroplast) [Alnus japonica]
ref|YP_009454881.1| photosystem II protein M (chloroplast) [Alnus maximowiczii]
ref|YP_009454966.1| photosystem II protein M (chloroplast) [Alnus nitida]
ref|YP_009455051.1| photosystem II protein M (chloroplast) [Alnus orientalis]
ref|YP_009455136.1| photosystem II protein M (chloroplast) [Alnus rubra]
ref|YP_009455221.1| photosystem II protein M (chloroplast) [Alnus subcordata]
ref|YP_009456784.1| photosystem II protein M (plastid) [Bergbambos tessellata]
ref|YP_009457938.1| photosystem II protein M (chloroplast) [Camellia japonica]
ref|YP_009456295.1| photosystem II protein M (chloroplast) [Ambrosia trifida]
ref|YP_009456536.1| photosystem II protein M (plastid) [Oldeania alpina]
ref|YP_009456619.1| photosystem II protein M (plastid) [Chimonobambusa tumidissinoda]
ref|YP_009456702.1| photosystem II protein M (plastid) [Ampelocalamus actinotrichus]
ref|YP_009456866.1| photosystem II protein M (plastid) [Oldeania humbertii]
ref|YP_009456949.1| photosystem II protein M (plastid) [Oldeania ibityensis]
ref|YP_009457032.1| photosystem II protein M (plastid) [Indocalamus sinicus]
ref|YP_009457115.1| photosystem II protein M (plastid) [Indosasa shibataeoides]
ref|YP_009457197.1| photosystem II protein M (plastid) [Oldeania itremoensis]
ref|YP_009457280.1| photosystem II protein M (plastid) [Kuruna debilis]
ref|YP_009457362.1| photosystem II protein M (plastid) [Oldeania cf. madagascariensis
PFM-2018]
ref|YP_009457445.1| photosystem II protein M (plastid) [Pseudosasa cantorii]
ref|YP_009457527.1| photosystem II protein M (plastid) [Sasa longiligulata]
ref|YP_009457610.1| photosystem II protein M (plastid) [Shibataea chiangshanensis]
ref|YP_009458683.1| photosystem II protein M (chloroplast) [Fagus engleriana]
ref|YP_009458767.1| photosystem II protein M (chloroplast) [Quercus glauca]
ref|YP_009458958.1| photosystem II protein M (chloroplast) [Oryza coarctata]
ref|YP_009459046.1| photosystem II protein M (chloroplast) [Amomum krervanh]
ref|YP_009459133.1| photosystem II protein M (chloroplast) [Quercus tungmaiensis]
ref|YP_009459520.1| photosystem II protein M (plastid) [Quercus sichourensis]
ref|YP_009460248.1| photosystem II protein M (plastid) [Cardamine amara]
ref|YP_009460333.1| photosystem II reaction center protein M (plastid) [Cardamine
oligosperma]
ref|YP_009460419.1| photosystem II reaction center protein M (plastid) [Cardamine
parviflora]
ref|YP_009460769.1| PSII M protein (plastid) [Galeopsis tetrahit]
ref|YP_009461026.1| PSII M protein (plastid) [Lamium album]
ref|YP_009461115.1| PSII M protein (plastid) [Lamium galeobdolon]
ref|YP_009461465.1| photosystem II protein M (plastid) [Ranunculus repens]
ref|YP_009461550.1| photosystem II protein M (plastid) [Ranunculus reptans]
ref|YP_009461721.1| photosystem II protein M (chloroplast) [Chionanthus parkinsonii]
ref|YP_009461809.1| photosystem II protein M (chloroplast) [Chionanthus rupicola]
ref|YP_009461897.1| photosystem II protein M (chloroplast) [Forestiera isabelae]
ref|YP_009461985.1| photosystem II protein M (chloroplast) [Forsythia x intermedia]
ref|YP_009462072.1| photosystem II protein M (chloroplast) [Nestegis apetala]
ref|YP_009462160.1| photosystem II protein M (chloroplast) [Noronhia lowryi]
ref|YP_009462248.1| photosystem II protein M (chloroplast) [Olea exasperata]
ref|YP_009462336.1| photosystem II protein M (chloroplast) [Schrebera arborea]
ref|YP_009462424.1| photosystem II protein M (chloroplast) [Syringa vulgaris]
ref|YP_009462805.1| photosystem II protein M (chloroplast) [Amomum compactum]
ref|YP_009463086.1| photosystem II protein M (chloroplast) [Magnolia aromatica]
ref|YP_009463172.1| photosystem II protein M (chloroplast) [Magnolia conifera]
ref|YP_009463258.1| photosystem II protein M (chloroplast) [Magnolia duclouxii]
ref|YP_009463344.1| photosystem II protein M (chloroplast) [Magnolia glaucifolia]
ref|YP_009463430.1| photosystem II protein M (chloroplast) [Magnolia dandyi]
ref|YP_009463516.1| photosystem II protein M (chloroplast) [Magnolia alba]
ref|YP_009466321.1| photosystem II protein M (chloroplast) [Genlisea filiformis]
ref|YP_009466396.1| photosystem II protein M (chloroplast) [Genlisea pygmaea]
ref|YP_009466471.1| photosystem II protein M (chloroplast) [Genlisea repens]
ref|YP_009466623.1| photosystem II protein M (chloroplast) [Genlisea violacea]
ref|YP_009466701.1| photosystem II protein M (chloroplast) [Acrocomia aculeata]
ref|YP_009467058.1| photosystem II protein M (chloroplast) [Schisandra sphenanthera]
ref|YP_009467588.1| photosystem II protein M (chloroplast) [Prosphytochloa prehensilis]
ref|YP_009468257.1| photosystem II protein M (chloroplast) [Drepanostachyum falcatum]
ref|YP_009468601.1| photosystem II protein M (plastid) [Fraxinus chiisanensis]
ref|YP_009468994.1| PsbM (chloroplast) [Streptocarpus teitensis]
ref|YP_009469132.1| PsbM (chloroplast) [Asarum sieboldii]
ref|YP_009469432.1| photosystem II protein M (chloroplast) [Anemoclema glaucifolium]
ref|YP_009470651.1| photosystem II protein M (chloroplast) [Anemopaegma acutifolium]
ref|YP_009470749.1| photosystem II protein M (chloroplast) [Anemopaegma album]
ref|YP_009470847.1| photosystem II protein M (chloroplast) [Anemopaegma arvense]
ref|YP_009470945.1| photosystem II protein M (chloroplast) [Anemopaegma chamberlaynii]
ref|YP_009471043.1| photosystem II protein M (chloroplast) [Anemopaegma foetidum]
ref|YP_009471141.1| photosystem II protein M (chloroplast) [Anemopaegma glaucum]
ref|YP_009471239.1| photosystem II protein M (chloroplast) [Anemopaegma oligoneuron]
ref|YP_009471622.1| photosystem II protein M (chloroplast) [Parrotia subaequalis]
ref|YP_009471817.1| photosystem II M protein (chloroplast) [Mentha spicata]
ref|AP_004922.1| photosystem II protein M (chloroplast) [Solanum lycopersicum]
sp|P62109.1|PSBM_ARATH RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M
sp|P62111.1|PSBM_TOBAC RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M
sp|P62112.1|PSBM_SPIOL RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M
sp|Q5IBK3.1|PSBM_PLALA RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M
sp|Q6ENI6.1|PSBM_ORYNI RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M
sp|Q6EW54.1|PSBM_NYMAL RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M
sp|Q7FNT0.1|PSBM_ATRBE RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M
sp|Q06H03.1|PSBM_DRIGR RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M
sp|Q06RD7.1|PSBM_JASNU RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M
sp|Q09G52.1|PSBM_PLAOC RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M
sp|Q1KXX3.1|PSBM_HELAN RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M
sp|Q2MIA6.1|PSBM_SOLLC RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M
sp|Q2MIJ3.1|PSBM_SOLBU RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M
sp|Q2VEI2.1|PSBM_SOLTU RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M
sp|Q33C43.1|PSBM_NICTO RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M
sp|Q3BAP6.1|PSBM_PHAAO RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M
sp|Q3C1G4.1|PSBM_NICSY RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M
sp|Q3V540.1|PSBM_ACOCL RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M
sp|Q0G9M5.1|PSBM_LIRTU RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M
sp|P0C411.1|PSBM_ORYSA RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M
sp|P0C412.1|PSBM_ORYSI RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M
sp|P0C413.1|PSBM_ORYSJ RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M
sp|A7Y3C1.1|PSBM_IPOPU RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M
sp|A4QJS7.1|PSBM_OLIPU RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M
sp|A4QK99.1|PSBM_BARVE RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M
sp|A4QKI6.1|PSBM_CAPBU RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M
sp|A4QKS5.1|PSBM_CRUWA RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M
sp|A4QLA0.1|PSBM_LEPVR RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M
sp|A4QLS7.1|PSBM_NASOF RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M
sp|A9L990.1|PSBM_LEMMI RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M
sp|A6MM30.1|PSBM_BUXMI RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M
sp|A6MMB6.1|PSBM_CHLSC RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M
sp|A6MMK1.1|PSBM_DIOEL RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M
sp|A6MMT8.1|PSBM_ILLOL RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M
pdb|3JCU|M Chain M, Cryo-em Structure Of Spinach Psii-lhcii Supercomplex At
3.2 Angstrom Resolution
pdb|3JCU|MM Chain m, Cryo-em Structure Of Spinach Psii-lhcii Supercomplex At
3.2 Angstrom Resolution
pdb|5MDX|M Chain M, Cryo-em Structure Of The Psii Supercomplex From
Arabidopsis Thaliana
pdb|5MDX|MM Chain m, Cryo-em Structure Of The Psii Supercomplex From
Arabidopsis Thaliana
gb|AAM08591.1|AC092750_25 Putative PSII low MW protein from chromosome 10 chloroplast
insertion [Oryza sativa Japonica Group]
gb|AAM48256.1|AC122148_9 Putative PSII low MW protein from chromosome 10 chloroplast
insertion [Oryza sativa Japonica Group]
emb|CAA33984.1| PSII low MW protein (chloroplast) [Oryza sativa Japonica Group]
emb|CAA77413.1| PSII M-protein (chloroplast) [Nicotiana tabacum]
dbj|BAA84379.1| PSII low MW protein (chloroplast) [Arabidopsis thaliana]
emb|CAB88719.1| PSII M-protein (chloroplast) [Spinacia oleracea]
emb|CAC88038.1| PSII M protein (chloroplast) [Atropa belladonna]
emb|CAD36619.1| photosystem II polypeptide M [Quercus petraea]
dbj|BAD26766.1| PSII low MW protein (chloroplast) [Oryza nivara]
emb|CAF28587.1| PSII low MW protein (chloroplast) [Nymphaea alba]
gb|AAW33074.1| photosystem II protein M (chloroplast) [Plantago australis]
gb|AAW33076.1| photosystem II protein M (chloroplast) [Plantago coronopus]
gb|AAW33078.1| photosystem II protein M (chloroplast) [Plantago lanceolata]
gb|AAW33080.1| photosystem II protein M (chloroplast) [Plantago media]
gb|AAW33082.1| photosystem II protein M (chloroplast) [Plantago rigida]
gb|AAW33084.1| photosystem II protein M (chloroplast) [Plantago rugelii]
gb|AAW82497.1| photosystem II M protein (chloroplast) [Phalaenopsis aphrodite
subsp. formosana]
gb|AAZ04027.1| photosystem II protein M, partial (chloroplast) [Acorus americanus]
gb|AAZ04029.1| photosystem II protein M, partial (chloroplast) [Nuphar advena]
gb|AAZ04030.1| photosystem II protein M, partial (chloroplast) [Ranunculus
macranthus]
gb|AAZ04031.1| photosystem II protein M, partial (chloroplast) [Typha latifolia]
gb|AAZ66142.1| PsbM (chloroplast) [Symplocos chinensis]
gb|AAZ66144.1| PsbM (chloroplast) [Symplocos paniculata]
gb|AAZ66148.1| PsbM (chloroplast) [Symplocos celastrinea]
gb|AAZ66152.1| PsbM (chloroplast) [Symplocos pentandra]
gb|AAZ66156.1| PsbM (chloroplast) [Symplocos tinctoria]
gb|AAZ66158.1| PsbM (chloroplast) [Symplocos lanata]
gb|AAZ66162.1| PsbM (chloroplast) [Symplocos austin-smithii]
gb|AAZ66164.1| PsbM (chloroplast) [Symplocos austin-smithii]
gb|AAZ66166.1| PsbM (chloroplast) [Symplocos austromexicana]
gb|AAZ66168.1| PsbM (chloroplast) [Symplocos berteroi]
gb|AAZ66170.1| PsbM (chloroplast) [Symplocos breedlovei]
gb|AAZ66172.1| PsbM (chloroplast) [Symplocos citrea]
gb|AAZ66174.1| PsbM (chloroplast) [Symplocos coccinea]
gb|AAZ66176.1| PsbM (chloroplast) [Symplocos costaricana]
gb|AAZ66178.1| PsbM (chloroplast) [Symplocos fuscata]
gb|AAZ66180.1| PsbM (chloroplast) [Symplocos hartwegii]
gb|AAZ66182.1| PsbM (chloroplast) [Symplocos limoncillo]
gb|AAZ66184.1| PsbM (chloroplast) [Symplocos martinicensis]
gb|AAZ66186.1| PsbM (chloroplast) [Symplocos matudae]
gb|AAZ66188.1| PsbM (chloroplast) [Symplocos nitens]
gb|AAZ66190.1| PsbM (chloroplast) [Symplocos povedae]
gb|AAZ66196.1| PsbM (chloroplast) [Symplocos reflexa]
gb|AAZ66198.1| PsbM (chloroplast) [Symplocos serrulata]
gb|AAZ66204.1| PsbM (chloroplast) [Symplocos sp. Clark et al. 8252]
gb|AAZ66208.1| PsbM (chloroplast) [Symplocos striata]
gb|AAZ66210.1| PsbM (chloroplast) [Symplocos sulcinervia]
gb|AAZ66214.1| PsbM (chloroplast) [Symplocos tribracteolata]
gb|AAZ66216.1| PsbM (chloroplast) [Symplocos uniflora]
gb|AAZ66218.1| PsbM (chloroplast) [Symplocos verrucisurcula]
gb|AAZ66220.1| PsbM (chloroplast) [Symplocos candelabra]
gb|AAZ66222.1| PsbM (chloroplast) [Symplocos falcata]
gb|AAZ66224.1| PsbM (chloroplast) [Symplocos falcata]
gb|AAZ66226.1| PsbM (chloroplast) [Symplocos organensis]
gb|AAZ66228.1| PsbM (chloroplast) [Symplocos microstyla]
gb|AAZ66232.1| PsbM (chloroplast) [Symplocos dryophila]
gb|AAZ66234.1| PsbM (chloroplast) [Symplocos lancifolia]
gb|AAZ66236.1| PsbM (chloroplast) [Symplocos macrophylla]
gb|AAZ66242.1| PsbM (chloroplast) [Symplocos ovatilobata]
gb|AAZ66252.1| PsbM (chloroplast) [Symplocos phyllocalyx]
gb|AAZ66254.1| PsbM (chloroplast) [Symplocos setchuensis]
gb|AAZ66256.1| PsbM (chloroplast) [Symplocos tetragona]
gb|AAZ66258.1| PsbM (chloroplast) [Symplocos arborea]
gb|AAZ66268.1| PsbM (chloroplast) [Symplocos sumuntia]
gb|AAZ66272.1| PsbM (chloroplast) [Symplocos adenophylla]
gb|AAZ66274.1| PsbM (chloroplast) [Symplocos congesta]
gb|AAZ66276.1| PsbM (chloroplast) [Symplocos euryoides]
gb|AAZ66282.1| PsbM (chloroplast) [Symplocos glomerata]
gb|AAZ66284.1| PsbM (chloroplast) [Symplocos grandis]
gb|AAZ66286.1| PsbM (chloroplast) [Symplocos stellaris]
gb|AAZ66288.1| PsbM (chloroplast) [Symplocos caerulescens]
emb|CAI53788.1| PSII low MW protein (plastid) [Acorus calamus]
dbj|BAE46642.1| PSII M-protein (chloroplast) [Nicotiana sylvestris]
dbj|BAE47992.1| PSII M-protein (chloroplast) [Nicotiana tomentosiformis]
gb|ABB90037.1| photosystem II M protein (chloroplast) [Solanum tuberosum]
gb|ABC56207.1| photosystem II protein M (chloroplast) [Solanum bulbocastanum]
gb|ABC56294.1| photosystem II protein M (chloroplast) [Solanum lycopersicum]
gb|ABC60452.1| photosystem II protein M (chloroplast) [Nuphar advena]
gb|ABC70750.1| photosystem II protein M (chloroplast) [Ranunculus macranthus]
gb|ABD47051.1| photosystem II protein M (chloroplast) [Solanum tuberosum]
gb|ABD47132.1| photosystem II protein M (chloroplast) [Helianthus annuus]
gb|ABD48489.1| PSII M protein (chloroplast) [Lemna minor]
emb|CAJ32387.1| photosystem II protein M (chloroplast) [Solanum lycopersicum]
gb|ABG74622.1| PSII M protein (chloroplast) [Jasminum nudiflorum]
gb|ABH88291.1| photosystem II protein M (chloroplast) [Drimys granadensis]
gb|ABI32503.1| photosystem II protein M (chloroplast) [Liriodendron tulipifera]
gb|ABI49772.1| photosystem II protein M (chloroplast) [Platanus occidentalis]
dbj|BAF49933.1| PSII low MW protein (chloroplast) [Olimarabidopsis pumila]
dbj|BAF50104.1| PSII low MW protein (chloroplast) [Barbarea verna]
dbj|BAF50191.1| PSII low MW protein (chloroplast) [Capsella bursa-pastoris]
dbj|BAF50280.1| PSII low MW protein (chloroplast) [Crucihimalaya wallichii]
dbj|BAF50455.1| PSII low MW protein (chloroplast) [Lepidium virginicum]
dbj|BAF50632.1| PSII low MW protein (chloroplast) [Nasturtium officinale]
gb|ABQ43254.1| photosystem II protein M (chloroplast) [Chloranthus spicatus]
gb|ABQ45243.1| photosystem II protein M (chloroplast) [Buxus microphylla]
gb|ABQ52513.1| photosystem II protein M (chloroplast) [Illicium oligandrum]
gb|ABR01424.1| photosystem II protein M (chloroplast) [Dioscorea elephantipes]
gb|ABU85342.1| photosystem II protein M, partial (chloroplast) [Elaeis oleifera]
gb|ABU85434.1| photosystem II protein M, partial (chloroplast) [Musa acuminata]
gb|ABU85580.1| photosystem II protein M, partial (chloroplast) [Scaevola aemula]
gb|ABV02342.1| photosystem II protein M (chloroplast) [Ipomoea purpurea]
gb|ABX38738.1| photosystem II protein M (chloroplast) [Acorus americanus]
gb|ABY79726.1| photosystem II protein M (chloroplast) [Fagopyrum esculentum subsp.
ancestrale]
gb|ACB86513.1| photosystem II protein M (chloroplast) [Guizotia abyssinica]
gb|ACN49317.1| photosystem II protein M (chloroplast) [Nelumbo lutea]
gb|ACN49402.1| photosystem II protein M (chloroplast) [Nelumbo nucifera]
gb|ACO92009.1| photosystem II protein M (chloroplast) [Megaleranthis
saniculifolia]
gb|ACS94666.1| PsbM (chloroplast) [Bambusa oldhamii]
gb|ACT15394.1| photosystem II protein M (chloroplast) [Anomochloa marantoidea]
gb|ACT99908.1| photosystem II protein M (chloroplast) [Dendrocalamus latiflorus]
gb|ADA63693.1| photosystem II protein M (chloroplast) [Typha latifolia]
gb|ADA69920.1| photosystem II protein M (chloroplast) [Olea europaea]
gb|ADD30417.1| photosystem II protein M (chloroplast) [Antirrhinum majus]
gb|ADD30419.1| photosystem II protein M (chloroplast) [Dillenia indica]
gb|ADD30420.1| photosystem II protein M (chloroplast) [Ehretia acuminata]
gb|ADD30421.1| photosystem II protein M (chloroplast) [Ilex cornuta]
gb|ADD30423.1| photosystem II protein M (chloroplast) [Meliosma aff. cuneifolia
Moore 333]
gb|ADD30424.1| photosystem II protein M (chloroplast) [Nelumbo nucifera]
gb|ADD30425.1| photosystem II protein M (chloroplast) [Nerium oleander]
gb|ADD30429.1| photosystem II protein M (chloroplast) [Berberidopsis corallina]
gb|ADD30434.1| photosystem II protein M (chloroplast) [Gunnera manicata]
gb|ADD30437.1| photosystem II protein M (chloroplast) [Oxalis latifolia]
gb|ADD30439.1| photosystem II protein M (chloroplast) [Quercus nigra]
gb|ADD30441.1| photosystem II protein M (chloroplast) [Trochodendron aralioides]
gb|ADD63166.1| photosystem II protein M (chloroplast) [Phoenix dactylifera]
gb|ADD72083.1| photosystem II protein M (chloroplast) [Olea europaea]
gb|ADF28140.1| photosystem II protein M (chloroplast) [Phoenix dactylifera]
gb|ADL39050.1| photosystem II protein M (chloroplast) [Magnolia kwangsiensis]
gb|ADN32880.1| photosystem II protein M (chloroplast) [Phyllostachys nigra var.
henonis]
gb|ADO33442.1| photosystem II protein M (plastid) [Smilax china]
gb|ADO65054.1| photosystem II protein M (chloroplast) [Castanea mollissima]
gb|ADO65131.1| photosystem II protein M (chloroplast) [Acidosasa purpurea]
gb|ADO65214.1| photosystem II protein M (plastid) [Ferrocalamus rimosivaginus]
gb|ADO65297.1| photosystem II protein M (plastid) [Indocalamus longiauritus]
gb|ADO65379.1| photosystem II protein M (chloroplast) [Phyllostachys edulis]
gb|ADO65463.1| photosystem II protein M (chloroplast) [Bambusa emeiensis]
dbj|BAJ24022.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24023.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24024.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24025.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24026.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24027.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24028.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24029.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24030.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24031.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24032.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24033.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24034.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24035.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24036.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24037.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24038.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24039.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24040.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24041.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24042.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24043.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24044.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24045.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24046.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24047.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24048.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24049.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24050.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24051.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24052.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24053.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24054.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24055.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24056.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24057.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24058.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24059.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24060.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24061.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24062.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24063.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24064.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24065.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24066.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24067.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24068.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24069.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
dbj|BAJ24070.1| photosystem II protein M (chloroplast) [Lysionotus chingii]
dbj|BAJ24071.1| photosystem II protein M (chloroplast) [Lysionotus chingii]
dbj|BAJ24072.1| photosystem II protein M (chloroplast) [Lysionotus chingii]
dbj|BAJ24073.1| photosystem II protein M (chloroplast) [Lysionotus oblongifolius]
dbj|BAJ24074.1| photosystem II protein M (chloroplast) [Lysionotus oblongifolius]
dbj|BAJ24075.1| photosystem II protein M (chloroplast) [Lysionotus oblongifolius]
dbj|BAJ24076.1| photosystem II protein M (chloroplast) [Lysionotus denticulosus]
dbj|BAJ24077.1| photosystem II protein M (chloroplast) [Lysionotus denticulosus]
dbj|BAJ24078.1| photosystem II protein M (chloroplast) [Lysionotus serratus]
gb|ADW94715.1| PsbM (plastid) [Streptocarpus papangae]
gb|ADW94717.1| PsbM (plastid) [Streptocarpus montanus]
gb|ADW94719.1| PsbM (plastid) [Streptocarpus fanniniae]
gb|ADW94720.1| PsbM (plastid) [Streptocarpus pusillus]
gb|ADW94722.1| PsbM (plastid) [Streptocarpus dunnii]
gb|ADW94724.1| PsbM (plastid) [Streptocarpus dunnii]
gb|ADW94726.1| PsbM (plastid) [Streptocarpus dunnii]
gb|ADW94728.1| PsbM (plastid) [Streptocarpus dunnii]
gb|ADW94730.1| PsbM (plastid) [Streptocarpus dunnii]
gb|ADW94732.1| PsbM (plastid) [Streptocarpus dunnii]
gb|ADW94734.1| PsbM (plastid) [Streptocarpus dunnii]
gb|ADW94736.1| PsbM (plastid) [Streptocarpus denticulatus]
gb|ADW94738.1| PsbM (plastid) [Streptocarpus denticulatus]
gb|ADW94740.1| PsbM (plastid) [Streptocarpus grandis]
gb|ADW94742.1| PsbM (plastid) [Streptocarpus grandis]
gb|ADW94744.1| PsbM (plastid) [Streptocarpus vandeleurii]
gb|ADW94746.1| PsbM (plastid) [Streptocarpus vandeleurii]
gb|ADW94748.1| PsbM (plastid) [Streptocarpus rimicola]
gb|ADW94750.1| PsbM (plastid) [Streptocarpus rimicola]
gb|ADW94752.1| PsbM (plastid) [Streptocarpus bolusii]
gb|ADW94754.1| PsbM (plastid) [Streptocarpus bolusii]
gb|ADW94756.1| PsbM (plastid) [Streptocarpus porphyrostachys]
gb|ADW94757.1| PsbM (plastid) [Streptocarpus polyanthus]
gb|ADW94759.1| PsbM (plastid) [Streptocarpus saundersii]
gb|ADW94761.1| PsbM (plastid) [Streptocarpus candidus]
gb|ADW94763.1| PsbM (plastid) [Streptocarpus gardenii]
gb|ADW94765.1| PsbM (plastid) [Streptocarpus gardenii]
gb|ADW94767.1| PsbM (plastid) [Streptocarpus gardenii]
gb|ADW94769.1| PsbM (plastid) [Streptocarpus gardenii]
gb|ADW94771.1| PsbM (plastid) [Streptocarpus gardenii]
gb|ADW94773.1| PsbM (plastid) [Streptocarpus gardenii]
gb|ADW94774.1| PsbM (plastid) [Streptocarpus kentaniensis]
gb|ADW94776.1| PsbM (plastid) [Streptocarpus lilliputana]
gb|ADW94778.1| PsbM (plastid) [Streptocarpus lilliputana]
gb|ADW94780.1| PsbM (plastid) [Streptocarpus aylae]
gb|ADW94782.1| PsbM (plastid) [Streptocarpus caeruleus]
gb|ADW94784.1| PsbM (plastid) [Streptocarpus caeruleus]
gb|ADW94786.1| PsbM (plastid) [Streptocarpus longiflorus]
gb|ADW94788.1| PsbM (plastid) [Streptocarpus parviflorus]
gb|ADW94790.1| PsbM (plastid) [Streptocarpus parviflorus subsp. parviflorus]
gb|ADW94792.1| PsbM (plastid) [Streptocarpus cyaneus subsp. nigridens]
gb|ADW94794.1| PsbM (plastid) [Streptocarpus cyaneus]
gb|ADW94796.1| PsbM (plastid) [Streptocarpus cyaneus]
gb|ADW94798.1| PsbM (plastid) [Streptocarpus floribundus]
gb|ADW94799.1| PsbM (plastid) [Streptocarpus meyeri]
gb|ADW94801.1| PsbM (plastid) [Streptocarpus meyeri]
gb|ADW94803.1| PsbM (plastid) [Streptocarpus meyeri]
gb|ADW94805.1| PsbM (plastid) [Streptocarpus meyeri]
gb|ADW94807.1| PsbM (plastid) [Streptocarpus meyeri]
gb|ADW94809.1| PsbM (plastid) [Streptocarpus meyeri]
gb|ADW94810.1| PsbM (plastid) [Streptocarpus meyeri]
gb|ADW94811.1| PsbM (plastid) [Streptocarpus meyeri]
gb|ADW94813.1| PsbM (plastid) [Streptocarpus meyeri]
gb|ADW94815.1| PsbM (plastid) [Streptocarpus meyeri]
gb|ADW94817.1| PsbM (plastid) [Streptocarpus meyeri]
gb|ADW94819.1| PsbM (plastid) [Streptocarpus meyeri]
gb|ADW94821.1| PsbM (plastid) [Streptocarpus meyeri]
gb|ADW94822.1| PsbM (plastid) [Streptocarpus meyeri]
gb|ADW94823.1| PsbM (plastid) [Streptocarpus meyeri]
gb|ADW94832.1| PsbM (plastid) [Streptocarpus baudertii]
gb|ADW94834.1| PsbM (plastid) [Streptocarpus johannis]
gb|ADW94836.1| PsbM (plastid) [Streptocarpus johannis]
gb|ADW94837.1| PsbM (plastid) [Streptocarpus johannis]
gb|ADW94838.1| PsbM (plastid) [Streptocarpus johannis]
gb|ADW94840.1| PsbM (plastid) [Streptocarpus modestus]
gb|ADW94842.1| PsbM (plastid) [Streptocarpus modestus]
gb|ADW94844.1| PsbM (plastid) [Streptocarpus formosus]
gb|ADW94846.1| PsbM (plastid) [Streptocarpus formosus]
gb|ADW94848.1| PsbM (plastid) [Streptocarpus formosus]
gb|ADW94850.1| PsbM (plastid) [Streptocarpus formosus]
gb|ADW94852.1| PsbM (plastid) [Streptocarpus primulifolius]
gb|ADW94854.1| PsbM (plastid) [Streptocarpus primulifolius]
gb|ADW94856.1| PsbM (plastid) [Streptocarpus primulifolius]
gb|ADW94858.1| PsbM (plastid) [Streptocarpus primulifolius]
gb|ADW94860.1| PsbM (plastid) [Streptocarpus primulifolius]
gb|ADW94862.1| PsbM (plastid) [Streptocarpus primulifolius]
gb|ADW94864.1| PsbM (plastid) [Streptocarpus primulifolius]
gb|ADW94865.1| PsbM (plastid) [Streptocarpus primulifolius]
gb|ADW94866.1| PsbM (plastid) [Streptocarpus primulifolius]
gb|ADW94867.1| PsbM (plastid) [Streptocarpus primulifolius]
gb|ADW94868.1| PsbM (plastid) [Streptocarpus primulifolius]
gb|ADW94869.1| PsbM (plastid) [Streptocarpus rexii]
gb|ADW94870.1| PsbM (plastid) [Streptocarpus rexii]
gb|ADW94871.1| PsbM (plastid) [Streptocarpus rexii]
gb|ADW94872.1| PsbM (plastid) [Streptocarpus rexii]
gb|ADZ10863.1| photosystem II protein M (chloroplast) [Elaeis guineensis]
emb|CBR30309.1| photosystem II protein M (plastid) [Olea europaea subsp. europaea]
gb|AEB72133.1| photosystem II protein M (chloroplast) [Solanum tuberosum]
gb|AEB72219.1| photosystem II protein M (chloroplast) [Solanum tuberosum]
gb|AEB96294.1| photosystem II protein M (chloroplast) [Phalaenopsis equestris]
gb|AEC03997.1| photosystem II protein M (chloroplast) [Silene conica]
gb|AEC04078.1| photosystem II protein M (chloroplast) [Silene latifolia]
gb|AEC04159.1| photosystem II protein M (chloroplast) [Silene noctiflora]
gb|AEC04241.1| photosystem II protein M (chloroplast) [Silene vulgaris]
emb|CBR23823.1| photosystem II protein M (chloroplast) [Olea europaea subsp.
cuspidata]
emb|CBR24614.1| photosystem II protein M (chloroplast) [Olea europaea subsp.
europaea]
emb|CBR30400.1| photosystem II protein M (plastid) [Olea europaea subsp. europaea]
emb|CBS29344.1| photosystem II protein M (chloroplast) [Olea woodiana subsp.
woodiana]
emb|CBS29231.1| photosystem II protein M (chloroplast) [Olea europaea subsp.
maroccana]
emb|CBJ04292.1| photosystem II protein M (chloroplast) [Olea europaea subsp.
cuspidata]
emb|CBR23732.1| photosystem II protein M (chloroplast) [Olea europaea subsp.
cuspidata]
gb|AEG64542.1| photosystem II protein M (chloroplast) [Ageratina adenophora]
gb|AEI53005.1| photosystem II protein M (chloroplast) [Oryza meridionalis]
gb|AEI53080.1| photosystem II protein M (chloroplast) [Oryza rufipogon]
gb|AEI53157.1| photosystem II protein M (chloroplast) [Oryza rufipogon]
gb|AEI70794.1| photosystem II protein M (chloroplast) [Puelia olyriformis]
gb|AEK48400.1| photosystem II protein M (chloroplast) [Colocasia esculenta]
gb|AEK48486.1| photosystem II protein M (chloroplast) [Colocasia esculenta]
gb|AEK53223.1| photosystem II protein M (chloroplast) [Dorcoceras hygrometricum]
gb|AEK94336.1| photosystem II protein M (chloroplast) [Spirodela polyrhiza]
gb|AEK94419.1| photosystem II protein M (chloroplast) [Wolffiella lingulata]
gb|AEK94502.1| photosystem II protein M (chloroplast) [Wolffia australiana]
gb|AEM65212.1| PsbM (chloroplast) [Magnolia denudata]
gb|AEO21166.1| photosystem II protein M (plastid) [Leersia tisserantii]
gb|AEO21249.1| photosystem II protein M (chloroplast) [Phyllostachys propinqua]
gb|AEO21332.1| photosystem II protein M (plastid) [Rhynchoryza subulata]
gb|AEO92700.1| PSII M protein (chloroplast) [Sesamum indicum]
gb|AEO95554.1| photosystem II protein M (chloroplast) [Nicotiana undulata]
gb|AEO95664.1| photosystem II protein M [synthetic construct]
gb|AEQ36932.1| photosystem II M protein (chloroplast) [Datura stramonium]
gb|AEQ37018.1| photosystem II M protein (chloroplast) [Datura stramonium]
gb|AER12808.1| photosystem II protein M (chloroplast) [Oryza sativa Indica Group]
gb|AER12973.1| photosystem II protein M (chloroplast) [Oryza sativa Indica Group]
dbj|BAL04669.1| photosystem II reaction center protein M (chloroplast) [Isodon
shikokianus var. occidentalis]
dbj|BAL04671.1| photosystem II reaction center protein M (chloroplast) [Isodon
shikokianus var. intermedius]
dbj|BAL04673.1| photosystem II reaction center protein M (chloroplast) [Isodon
japonicus]
dbj|BAL04675.1| photosystem II reaction center protein M (chloroplast) [Isodon
trichocarpus]
dbj|BAL04677.1| photosystem II reaction center protein M (chloroplast) [Isodon
effusus]
dbj|BAL04679.1| photosystem II reaction center protein M (chloroplast) [Isodon
shikokianus var. intermedius]
dbj|BAL04681.1| photosystem II reaction center protein M (chloroplast) [Isodon
effusus]
dbj|BAL04683.1| photosystem II reaction center protein M (chloroplast) [Isodon
umbrosus]
dbj|BAL04685.1| photosystem II reaction center protein M (chloroplast) [Isodon
trichocarpus]
dbj|BAL04687.1| photosystem II reaction center protein M (chloroplast) [Isodon
inflexus]
dbj|BAL04689.1| photosystem II reaction center protein M (chloroplast) [Isodon
inflexus]
dbj|BAL04691.1| photosystem II reaction center protein M (chloroplast) [Isodon
shikokianus var. occidentalis]
dbj|BAL04693.1| photosystem II reaction center protein M (chloroplast) [Isodon
longitubus]
dbj|BAL04695.1| photosystem II reaction center protein M (chloroplast) [Isodon
japonicus]
dbj|BAL04697.1| photosystem II reaction center protein M (chloroplast) [Isodon
excisus]
dbj|BAL04699.1| photosystem II reaction center protein M (chloroplast) [Isodon
longitubus]
gb|AEX37335.1| photosystem II protein M (chloroplast) [Arbutus unedo]
gb|AEX65388.1| photosystem II protein M, partial (chloroplast) [Blossfeldia
liliputana]
gb|AEX65389.1| photosystem II protein M, partial (chloroplast) [Didierea
madagascariensis]
gb|AEX65391.1| photosystem II protein M, partial (chloroplast) [Mollugo
verticillata]
gb|AEX65394.1| photosystem II protein M, partial (chloroplast) [Pereskiopsis
diguetii]
gb|AEX98328.1| photosystem II M protein (chloroplast) [Magnolia denudata]
gb|AEX98496.1| photosystem II M protein (chloroplast) [Magnolia officinalis]
gb|AEX98578.1| photosystem II M protein (chloroplast) [Magnolia officinalis subsp.
biloba]
gb|AEX98662.1| photosystem II M protein (chloroplast) [Magnolia officinalis subsp.
biloba]
gb|AEX98746.1| photosystem II M protein (chloroplast) [Magnolia officinalis subsp.
biloba]
gb|AEX98913.1| photosystem II M protein (chloroplast) [Magnolia grandiflora]
gb|AEX99081.1| photosystem II M protein (chloroplast) [Magnolia grandiflora]
gb|AEY84646.1| photosystem II protein M (chloroplast) [Elodea canadensis]
gb|AEZ01421.1| photosystem II protein M (chloroplast) [Japonolirion osense]
gb|AFA26836.1| photosystem II protein M (plastid) [Albuca kirkii]
gb|AFA26839.1| photosystem II protein M, partial (plastid) [Belosynapsis ciliata]
gb|AFA26840.1| photosystem II protein M, partial (plastid) [Brocchinia micrantha]
gb|AFA26841.1| photosystem II protein M (plastid) [Centrolepis monogyna]
gb|AFA26842.1| photosystem II protein M, partial (plastid) [Chamaedorea seifrizii]
gb|AFA26845.1| photosystem II protein M (plastid) [Dasypogon bromeliifolius]
gb|AFA26849.1| photosystem II protein M, partial (plastid) [Fosterella caulescens]
gb|AFA26855.1| photosystem II protein M (plastid) [Juncus effusus]
gb|AFA26856.1| photosystem II protein M, partial (plastid) [Kingia australis]
gb|AFA26859.1| photosystem II protein M, partial (plastid) [Navia saxicola]
gb|AFA26861.1| photosystem II protein M, partial (plastid) [Neoregelia carolinae]
gb|AFA26865.1| photosystem II protein M, partial (plastid) [Pitcairnia feliciana]
gb|AFA26866.1| photosystem II protein M, partial (plastid) [Potarophytum riparium]
gb|AFA26867.1| photosystem II protein M, partial (plastid) [Puya laxa]
gb|AFA26868.1| photosystem II protein M, partial (plastid) [Ravenea hildebrandtii]
gb|AFA26869.1| photosystem II protein M, partial (plastid) [Renealmia alpinia]
gb|AFA26870.1| photosystem II protein M, partial (plastid) [Sparganium eurycarpum]
gb|AFA26871.1| photosystem II protein M (plastid) [Syngonanthus chrysanthus]
gb|AFA26872.1| photosystem II protein M (plastid) [Thamnochortus insignis]
gb|AFA26874.1| photosystem II protein M, partial (plastid) [Tradescantia ohiensis]
gb|AFH01441.1| photosystem II protein M (chloroplast) [Nelumbo nucifera]
gb|AFH01535.1| photosystem II protein M (chloroplast) [Nelumbo lutea]
gb|AFK81293.1| photosystem II protein M (plastid) [Camellia sinensis var.
assamica]
gb|AFK81380.1| photosystem II protein M (plastid) [Camellia oleifera]
gb|AFK81467.1| photosystem II protein M (plastid) [Camellia taliensis]
gb|AFM83287.1| photosystem II protein M (chloroplast) [Kingia australis]
gb|AFM92273.1| photosystem II protein M (chloroplast) [Pachycladon cheesemanii]
gb|AFP90770.1| photosystem II protein M (chloroplast) [Capsicum annuum]
gb|AFP92303.1| photosystem II protein M (chloroplast) [Magnolia acuminata var.
acuminata]
gb|AFP92389.1| photosystem II protein M (chloroplast) [Magnolia cathcartii]
gb|AFP92475.1| photosystem II protein M (chloroplast) [Magnolia macrophylla var.
dealbata]
gb|AFP92561.1| photosystem II protein M (chloroplast) [Magnolia denudata]
gb|AFP92647.1| photosystem II protein M (chloroplast) [Magnolia pyramidata]
gb|AFP92733.1| photosystem II protein M (chloroplast) [Magnolia kobus]
gb|AFP92819.1| photosystem II protein M (chloroplast) [Magnolia liliiflora]
gb|AFP92903.1| photosystem II protein M (chloroplast) [Magnolia odora]
gb|AFP92991.1| photosystem II protein M (chloroplast) [Magnolia salicifolia]
gb|AFP93077.1| photosystem II protein M (chloroplast) [Magnolia sinica]
gb|AFP93163.1| photosystem II protein M (chloroplast) [Magnolia sprengeri]
gb|AFQ30923.1| photosystem II M protein (chloroplast) [Salvia miltiorrhiza]
gb|AFR25654.1| photosystem II protein M (chloroplast) [Penthorum chinense]
gb|AFS67053.1| photosystem II protein M (chloroplast) [Arundinaria fargesii]
gb|AFS67136.1| photosystem II protein M (chloroplast) [Sarocalamus faberi]
gb|AFS67220.1| photosystem II protein M (chloroplast) [Chimonocalamus
longiusculus]
gb|AFS67302.1| photosystem II protein M (chloroplast) [Fargesia nitida]
gb|AFS67385.1| photosystem II protein M (chloroplast) [Fargesia spathacea]
gb|AFS67468.1| photosystem II protein M (chloroplast) [Fargesia yunnanensis]
gb|AFS67551.1| photosystem II protein M (chloroplast) [Gaoligongshania
megalothyrsa]
gb|AFS67634.1| photosystem II protein M (chloroplast) [Gelidocalamus tessellatus]
gb|AFS67717.1| photosystem II protein M (chloroplast) [Indocalamus wilsonii]
gb|AFS67800.1| photosystem II protein M (chloroplast) [Indosasa sinica]
gb|AFS67882.1| photosystem II protein M (chloroplast) [Oligostachyum
shiuyingianum]
gb|AFS67964.1| photosystem II protein M (chloroplast) [Pleioblastus maculatus]
gb|AFS68046.1| photosystem II protein M (chloroplast) [Thamnocalamus spathiflorus]
gb|AFS68129.1| photosystem II protein M (chloroplast) [Yushania levigata]
gb|AFU93998.1| PsbM, partial (chloroplast) [Medusagyne oppositifolia]
gb|AFU94006.1| PsbM, partial (chloroplast) [Rhizophora mangle]
gb|AFV61808.1| PSII M protein (chloroplast) [Origanum vulgare subsp. vulgare]
gb|AFY64181.1| photosystem II protein M (chloroplast) [Najas flexilis]
gb|AGA55590.1| PSII M protein (chloroplast) [Camellia sinensis]
emb|CCP47124.1| photosystem II protein M (chloroplast) [Tectona grandis]
emb|CCP47213.1| photosystem II protein M (chloroplast) [Tectona grandis]
emb|CCP47302.1| photosystem II protein M (chloroplast) [Tectona grandis]
gb|AGC31240.1| photosystem II protein M (plastid) [Quercus rubra]
gb|AGC38151.1| photosystem II protein M (chloroplast) [Arundinaria gigantea]
gb|AGE65744.1| photosystem II protein M (chloroplast) [Pharus lappulaceus]
gb|AGE92678.1| photosystem II protein M (plastid) [Heliconia collinsiana]
gb|AGE92763.1| photosystem II protein M (plastid) [Zingiber spectabile]
gb|AGE92848.1| photosystem II protein M (plastid) [Pseudophoenix vinifera]
gb|AGE92934.1| photosystem II protein M (plastid) [Calamus caryotoides]
gb|AGE93020.1| photosystem II protein M (plastid) [Bismarckia nobilis]
gb|AGE93106.1| photosystem II protein M (plastid) [Dasypogon bromeliifolius]
gb|AGE93278.1| photosystem II protein M (plastid) [Chamaedorea seifrizii]
gb|AGE93364.1| photosystem II protein M (plastid) [Alpinia zerumbet]
gb|AGE93450.1| photosystem II protein M (plastid) [Xiphidium caeruleum]
emb|CCJ32511.1| PsbM (chloroplast) [Trithuria inconspicua]
gb|AGH33761.1| photosystem II protein M (chloroplast) [Puelia olyriformis]
gb|AGI51138.1| photosystem II protein M (chloroplast) [Catharanthus roseus]
gb|AGJ51250.1| photosystem II protein M (chloroplast) [Solanum carolinense]
gb|AGJ72051.1| photosystem II protein M (chloroplast) [Tetracentron sinense]
gb|AGJ72143.1| photosystem II protein M (chloroplast) [Trochodendron aralioides]
gb|AGL45330.1| PsbM (chloroplast) [Sesamum indicum]
gb|AGL61069.1| photosystem II protein M (chloroplast) [Utricularia gibba]
gb|AGL81771.1| photosystem II protein M (plastid) [Streptocarpus cooksonii]
gb|AGL81773.1| photosystem II protein M (plastid) [Streptocarpus daviesii]
gb|AGL81775.1| photosystem II protein M (plastid) [Streptocarpus daviesii]
gb|AGL81777.1| photosystem II protein M (plastid) [Streptocarpus grandis]
gb|AGL81779.1| photosystem II protein M (plastid) [Streptocarpus grandis]
gb|AGL81781.1| photosystem II protein M (plastid) [Streptocarpus grandis]
gb|AGL81783.1| photosystem II protein M (plastid) [Streptocarpus grandis]
gb|AGL81785.1| photosystem II protein M (plastid) [Streptocarpus hilsenbergii]
gb|AGL81787.1| photosystem II protein M (plastid) [Streptocarpus huamboensis]
gb|AGL81789.1| photosystem II protein M (plastid) [Streptocarpus makabengensis]
gb|AGL81791.1| photosystem II protein M (plastid) [Streptocarpus sp. MdV-2012]
gb|AGL81793.1| photosystem II protein M (plastid) [Streptocarpus sp. MdV-2012]
gb|AGL81795.1| photosystem II protein M (plastid) [Streptocarpus molweniensis]
gb|AGL81797.1| photosystem II protein M (plastid) [Streptocarpus monophyllus]
gb|AGL81799.1| photosystem II protein M (plastid) [Streptocarpus occultus]
gb|AGL81801.1| photosystem II protein M (plastid) [Streptocarpus saundersii]
gb|AGL81803.1| photosystem II protein M (plastid) [Streptocarpus wendlandii]
gb|AGL81805.1| photosystem II protein M (plastid) [Streptocarpus wilmsii]
gb|AGL81807.1| photosystem II protein M (plastid) [Streptocarpus monophyllus]
emb|CCQ09096.1| photosystem II protein M (chloroplast) [Olea europaea subsp.
europaea]
gb|AGN72208.1| photosystem II protein M (chloroplast) [Arundinaria appalachiana]
gb|AGN72291.1| photosystem II protein M (chloroplast) [Arundinaria tecta]
gb|AGN73974.1| photosystem II M protein (chloroplast) [Aconitum barbatum var.
puberulum]
gb|AGO98518.1| photosystem II protein M (chloroplast) [Nelumbo nucifera]
gb|AGQ55669.1| photosystem II protein M (chloroplast) [Alstroemeria aurea]
emb|CCW72369.1| psbM (chloroplast) [Musa acuminata subsp. malaccensis]
gb|AGS43460.1| photosystem II protein M (chloroplast) [Cocos nucifera]
gb|AGT79840.1| PSII M protein (chloroplast) [Andrographis paniculata]
gb|AGU44293.1| photosystem II protein M (chloroplast) [Camellia cuspidata]
gb|AGU44378.1| photosystem II protein M (chloroplast) [Camellia danzaiensis]
gb|AGU44469.1| photosystem II protein M (chloroplast) [Camellia impressinervis]
gb|AGU44558.1| photosystem II protein M (chloroplast) [Camellia taliensis]
gb|AGU44647.1| photosystem II protein M (chloroplast) [Camellia pitardii]
gb|AGU44736.1| photosystem II protein M (chloroplast) [Camellia yunnanensis]
gb|AGU44825.1| photosystem II protein M (chloroplast) [Camellia taliensis]
gb|AGU46460.1| photosystem II protein M (plastid) [Hyoscyamus niger]
gb|AGW96331.1| photosystem II protein M (chloroplast) [Ipomoea batatas]
gb|AGW96416.1| photosystem II protein M (chloroplast) [Ipomoea batatas]
gb|AGW96501.1| photosystem II protein M (chloroplast) [Ipomoea batatas]
gb|AGW96586.1| photosystem II protein M (chloroplast) [Ipomoea trifida]
gb|AGW96670.1| photosystem II protein M (chloroplast) [Argyreia nervosa]
gb|AGW96755.1| photosystem II protein M (chloroplast) [Ipomoea amnicola]
gb|AGW96840.1| photosystem II protein M (chloroplast) [Ipomoea argillicola]
gb|AGW96925.1| photosystem II protein M (chloroplast) [Ipomoea cairica]
gb|AGW97010.1| photosystem II protein M (chloroplast) [Ipomoea diamantinensis]
gb|AGW97180.1| photosystem II protein M (chloroplast) [Ipomoea eriocarpa]
gb|AGW97265.1| photosystem II protein M (chloroplast) [Ipomoea hederifolia]
gb|AGW97350.1| photosystem II protein M (chloroplast) [Ipomoea involucrata]
gb|AGW97435.1| photosystem II protein M (chloroplast) [Ipomoea murucoides]
gb|AGW97520.1| photosystem II protein M (chloroplast) [Ipomoea nil]
gb|AGW97605.1| photosystem II protein M (chloroplast) [Ipomoea orizabensis]
gb|AGW97690.1| photosystem II protein M (chloroplast) [Ipomoea pedicellaris]
gb|AGW97775.1| photosystem II protein M (chloroplast) [Ipomoea pes-caprae]
gb|AGW97860.1| photosystem II protein M (chloroplast) [Ipomoea polpha]
gb|AGW97945.1| photosystem II protein M (chloroplast) [Ipomoea setosa]
gb|AGW98029.1| photosystem II protein M (chloroplast) [Ipomoea splendor-sylvae]
gb|AGW98114.1| photosystem II protein M (chloroplast) [Ipomoea ternifolia]
gb|AGW98199.1| photosystem II protein M (chloroplast) [Ipomoea tricolor]
gb|AGW98284.1| photosystem II protein M (chloroplast) [Ipomoea trifida]
gb|AGW98369.1| photosystem II protein M (chloroplast) [Ipomoea cordatotriloba]
gb|AGW98454.1| photosystem II protein M (chloroplast) [Ipomoea minutiflora]
gb|AGW98539.1| photosystem II protein M (chloroplast) [Ipomoea obscura]
gb|AGW98624.1| photosystem II protein M (chloroplast) [Ipomoea pes-tigridis]
gb|AGW98709.1| photosystem II protein M (chloroplast) [Merremia quinquefolia]
gb|AGW98794.1| photosystem II protein M (chloroplast) [Operculina macrocarpa]
gb|AGW98879.1| photosystem II protein M (chloroplast) [Stictocardia macalusoi]
gb|AGW98964.1| photosystem II protein M (chloroplast) [Turbina corymbosa]
gb|AGX29600.1| photosystem II protein M (chloroplast) [Aster spathulifolius]
gb|AGY93097.1| photosystem II protein M (chloroplast) [Oryza nivara]
gb|AGY93184.1| photosystem II protein M (chloroplast) [Oryza rufipogon]
gb|AGY93271.1| photosystem II protein M (chloroplast) [Oryza glaberrima]
gb|AGY93358.1| photosystem II protein M (chloroplast) [Oryza barthii]
gb|AGY93445.1| photosystem II protein M (chloroplast) [Oryza glumipatula]
gb|AGY93532.1| photosystem II protein M (chloroplast) [Oryza meridionalis]
gb|AGY93619.1| photosystem II protein M (chloroplast) [Oryza longistaminata]
gb|AGY93706.1| photosystem II protein M (chloroplast) [Oryza punctata]
gb|AGY93793.1| photosystem II protein M (chloroplast) [Oryza minuta]
gb|AGY93880.1| photosystem II protein M (chloroplast) [Oryza officinalis]
gb|AGY93967.1| photosystem II protein M (chloroplast) [Oryza rhizomatis]
gb|AGY94054.1| photosystem II protein M (chloroplast) [Oryza eichingeri]
gb|AGY94315.1| photosystem II protein M (chloroplast) [Oryza latifolia]
gb|AGY94402.1| photosystem II protein M (chloroplast) [Oryza australiensis]
gb|AGY94489.1| photosystem II protein M (chloroplast) [Oryza brachyantha]
gb|AGY94575.1| photosystem II protein M (chloroplast) [Oryza longiglumis]
gb|AGY94663.1| photosystem II protein M (chloroplast) [Oryza ridleyi]
gb|AGY94750.1| photosystem II protein M (chloroplast) [Oryza meyeriana var.
granulata]
gb|AGY94837.1| photosystem II protein M (chloroplast) [Oryza meyeriana]
gb|AGY94923.1| photosystem II protein M (chloroplast) [Leersia japonica]
gb|AGZ13228.1| photosystem II protein M (plastid) [Olyra latifolia]
gb|AGZ17999.1| photosystem II protein M (chloroplast) [Silene conoidea]
gb|AGZ18080.1| photosystem II protein M (chloroplast) [Silene chalcedonica]
gb|AGZ18160.1| photosystem II protein M (chloroplast) [Silene paradoxa]
gb|AGZ19137.1| photosystem II protein M (chloroplast) [Camellia sinensis]
gb|AGZ19202.1| photosystem II protein M (chloroplast) [Oryza rufipogon]
emb|CDI43912.1| photosystem II protein M (chloroplast) [Lindenbergia philippensis]
gb|AHA12508.1| photosystem II protein M (plastid) [Musa textilis]
gb|AHA12594.1| photosystem II protein M (plastid) [Ravenala madagascariensis]
gb|AHA12677.1| photosystem II protein M (plastid) [Orchidantha fimbriata]
gb|AHA12749.1| photosystem II protein M (plastid) [Canna indica]
gb|AHA12833.1| photosystem II protein M (plastid) [Maranta leuconeura]
gb|AHA12918.1| photosystem II protein M (plastid) [Monocostus uniflorus]
gb|AHA13004.1| photosystem II protein M (plastid) [Costus pulverulentus]
gb|AHA13090.1| photosystem II protein M (plastid) [Curcuma roscoeana]
gb|AHA13176.1| photosystem II protein M (plastid) [Thaumatococcus daniellii]
gb|AHA84923.1| photosystem II protein M (plastid) [Ajuga reptans]
gb|AHB14443.1| photosystem II protein M (plastid) [Helianthus giganteus]
gb|AHB14528.1| photosystem II protein M (plastid) [Helianthus giganteus]
gb|AHB14613.1| photosystem II protein M (plastid) [Helianthus giganteus]
gb|AHB14698.1| photosystem II protein M (plastid) [Helianthus giganteus]
gb|AHB14783.1| photosystem II protein M (plastid) [Helianthus grosseserratus]
gb|AHB14868.1| photosystem II protein M (plastid) [Helianthus grosseserratus]
gb|AHB14953.1| photosystem II protein M (plastid) [Helianthus divaricatus]
gb|AHB15038.1| photosystem II protein M (plastid) [Helianthus divaricatus]
gb|AHB15123.1| photosystem II protein M (plastid) [Helianthus divaricatus]
gb|AHB15208.1| photosystem II protein M (plastid) [Helianthus divaricatus]
gb|AHB15293.1| photosystem II protein M (plastid) [Helianthus decapetalus]
gb|AHB15378.1| photosystem II protein M (plastid) [Helianthus decapetalus]
gb|AHB15463.1| photosystem II protein M (plastid) [Helianthus decapetalus]
gb|AHB15548.1| photosystem II protein M (plastid) [Helianthus hirsutus]
gb|AHB15633.1| photosystem II protein M (plastid) [Helianthus hirsutus]
gb|AHB15718.1| photosystem II protein M (plastid) [Helianthus tuberosus]
gb|AHB15803.1| photosystem II protein M (plastid) [Helianthus tuberosus]
gb|AHB15888.1| photosystem II protein M (plastid) [Helianthus tuberosus]
gb|AHB15973.1| photosystem II protein M (plastid) [Helianthus divaricatus]
gb|AHB16058.1| photosystem II protein M (plastid) [Helianthus giganteus]
gb|AHB16143.1| photosystem II protein M (plastid) [Helianthus giganteus]
gb|AHB16228.1| photosystem II protein M (plastid) [Helianthus grosseserratus]
gb|AHB16313.1| photosystem II protein M (plastid) [Helianthus grosseserratus]
gb|AHB16398.1| photosystem II protein M (plastid) [Helianthus grosseserratus]
gb|AHB16483.1| photosystem II protein M (plastid) [Helianthus grosseserratus]
gb|AHB16568.1| photosystem II protein M (plastid) [Helianthus decapetalus]
gb|AHB16653.1| photosystem II protein M (plastid) [Helianthus decapetalus]
gb|AHB16738.1| photosystem II protein M (plastid) [Helianthus decapetalus]
gb|AHB16823.1| photosystem II protein M (plastid) [Helianthus hirsutus]
gb|AHB16908.1| photosystem II protein M (plastid) [Helianthus hirsutus]
gb|AHB16993.1| photosystem II protein M (plastid) [Helianthus strumosus]
gb|AHB17078.1| photosystem II protein M (plastid) [Helianthus tuberosus]
gb|AHB17163.1| photosystem II protein M (plastid) [Helianthus tuberosus]
gb|AHB17248.1| photosystem II protein M (plastid) [Helianthus tuberosus]
gb|AHB17333.1| photosystem II protein M (plastid) [Helianthus maximiliani]
gb|AHB17418.1| photosystem II protein M (plastid) [Helianthus maximiliani]
gb|AHB17503.1| photosystem II protein M (plastid) [Helianthus maximiliani]
gb|AHB17588.1| photosystem II protein M (plastid) [Helianthus maximiliani]
emb|CDJ38613.1| photosystem II protein M (chloroplast) [Schwalbea americana]
gb|AHB38648.1| photosystem II protein M (chloroplast) [Trithuria filamentosa]
gb|AHF71634.1| photosystem II protein M (chloroplast) [Camellia crapnelliana]
gb|AHF71722.1| photosystem II protein M (chloroplast) [Nymphaea mexicana]
gb|AHF72166.1| photosystem II protein M (chloroplast) [Magnolia yunnanensis]
emb|CCQ71614.1| photosystem II protein M (chloroplast) [Salvia miltiorrhiza]
emb|CDL78808.1| photosystem II protein M (chloroplast) [Pinguicula ehlersiae]
gb|AHH24327.1| photosystem II protein M (chloroplast) [Japonolirion osense]
gb|AHH30435.1| photosystem II protein M (chloroplast) [Neobartsia inaequalis]
gb|AHI45608.1| photosystem II protein M (plastid) [Sabal domingensis]
gb|AHI87521.1| photosystem II protein M (chloroplast) [Chionographis japonica]
gb|AHL16901.1| photosystem II protein M (chloroplast) [Castanopsis echinocarpa]
gb|AHM02389.1| photosystem II protein M (chloroplast) [Praxelis clematidea]
gb|AHN07164.1| photosystem II protein M (plastid) [Cardamine impatiens]
gb|AHN07249.1| photosystem II protein M (plastid) [Cardamine resedifolia]
gb|AHN16119.1| photosystem II protein M (chloroplast) [Trigonobalanus
doichangensis]
gb|AHW51952.1| photosystem II protein M (plastid) [Magnolia tripetala]
gb|AHW52178.1| photosystem II protein M (chloroplast) [Rhazya stricta]
gb|AHY86169.1| photosystem II protein M (plastid) [Ampelocalamus calcareus]
gb|AHZ18125.1| photosystem II protein M (plastid) [Dioscorea rotundata]
gb|AHZ42965.1| photosystem II protein M (chloroplast) [Cypripedium formosanum]
gb|AHZ60699.1| photosystem II protein M (plastid) [Oryza glaberrima]
gb|AHZ61367.1| photosystem II protein M (plastid) [Bergbambos tessellata]
gb|AIA24166.1| photosystem II protein M (plastid) [Indocalamus sinicus]
gb|AIA24211.1| photosystem II protein M (plastid) [Oldeania alpina]
gb|AIA76956.1| photosystem II protein M (chloroplast) (chloroplast) [Capsicum
annuum var. glabriusculum]
gb|AIB08727.1| photosystem II protein M (plastid) [Rhazya stricta]
gb|AIC37268.1| photosystem II protein M (plastid) [Cypripedium japonicum]
gb|AIE44563.1| photosystem II protein M (chloroplast) [Oryza australiensis]
gb|AIG61247.1| photosystem II protein M (chloroplast) [Camellia grandibracteata]
gb|AIG61334.1| photosystem II protein M (chloroplast) [Camellia leptophylla]
gb|AIG61421.1| photosystem II protein M (chloroplast) [Camellia petelotii]
gb|AIG61508.1| photosystem II protein M (chloroplast) [Camellia pubicosta]
gb|AIG61595.1| photosystem II protein M (chloroplast) [Camellia reticulata]
gb|AIG61683.1| photosystem II protein M (chloroplast) [Camellia sinensis var.
dehungensis]
gb|AIG61770.1| photosystem II protein M (chloroplast) [Camellia sinensis var.
pubilimba]
gb|AIG61857.1| photosystem II protein M (chloroplast) [Camellia sinensis var.
sinensis]
gb|AIH00226.1| photosystem II protein M (chloroplast) [Bambusa multiplex]
gb|AIH00311.1| photosystem II protein M (chloroplast) [Phyllostachys sulphurea]
gb|AIM52856.1| photosystem II protein M (plastid) [Bambusa bambos]
gb|AIM52940.1| photosystem II protein M (plastid) [Bambusa arnhemica]
gb|AIM53024.1| photosystem II protein M (plastid) [Chusquea spectabilis]
gb|AIM53108.1| photosystem II protein M (plastid) [Diandrolyra sp. Clark 1301]
gb|AIM53188.1| photosystem II protein M (plastid) [Eremitis sp. Clark & Zhang
1343]
gb|AIM53268.1| photosystem II protein M (plastid) [Greslania sp. McPherson 19217]
gb|AIM53352.1| photosystem II protein M (plastid) [Hickelia madagascariensis]
gb|AIM53436.1| photosystem II protein M (plastid) [Neohouzeaua sp. Clark &
Attigala 1712]
gb|AIM53520.1| photosystem II protein M (plastid) [Neololeba atra]
gb|AIM53604.1| photosystem II protein M (plastid) [Olmeca reflexa]
gb|AIM53688.1| photosystem II protein M (plastid) [Raddia brasiliensis]
gb|AIM53856.1| photosystem II protein M (plastid) [Buergersiochloa bambusoides]
gb|AIM53939.1| photosystem II protein M (plastid) [Chusquea liebmannii]
gb|AIM54022.1| photosystem II protein M (plastid) [Lithachne pauciflora]
gb|AIM54102.1| photosystem II protein M (plastid) [Otatea acuminata]
gb|AIM54186.1| photosystem II protein M (plastid) [Pariana radiciflora]
gb|AIM54266.1| photosystem II protein M (plastid) [Thamnocalamus spathiflorus]
gb|AIN81003.1| photosystem II protein M (chloroplast) [Zingiber officinale]
gb|AIP85225.1| PsbM (chloroplast) [Camellia sinensis]
gb|AIQ81091.1| photosystem II protein M (chloroplast) [Clematis terniflora]
gb|AIR12597.1| photosystem II protein M (plastid) [Bomarea edulis]
gb|AIS67526.1| photosystem II protein M (chloroplast) [Phragmipedium longifolium]
gb|AIT15986.1| photosystem II protein M (chloroplast) [Luzuriaga radicans]
gb|AIU44765.1| photosystem II protein M (chloroplast) [Phalaenopsis hybrid
cultivar]
gb|AIU98530.1| photosystem II protein M (chloroplast) [Cynara cardunculus var.
scolymus]
emb|CDI43995.1| photosystem II protein M (chloroplast) [Genlisea margaretae]
emb|CDL78730.1| photosystem II protein M (chloroplast) [Utricularia macrorhiza]
gb|AIW05429.1| photosystem II protein M (plastid) [Neobracea bahamensis]
gb|AIW05514.1| photosystem II protein M (plastid) [Nerium oleander]
gb|AIW05938.1| photosystem II protein M (plastid) [Wrightia natalensis]
gb|AIW51833.1| photosystem II protein M (chloroplast) [Lasthenia burkei]
gb|AIW56411.1| photosystem II protein M (chloroplast) [Xerophyllum tenax]
gb|AIW56498.1| photosystem II protein M (chloroplast) [Heloniopsis tubiflora]
gb|AIX03510.1| photosystem II protein M (plastid) [Thalictrum coreanum]
gb|AIX89737.1| PsbM (chloroplast) [Fagopyrum tataricum]
emb|CED79756.1| photosystem II protein M (chloroplast) [Hesperelaea palmeri]
gb|AIY33816.1| photosystem II protein M (chloroplast) [Nelumbo nucifera]
gb|AIY72374.1| PsbM (chloroplast) [Carthamus tinctorius]
gb|AIZ57527.1| photosystem II protein M (chloroplast) [Clematis fusca var.
coreana]
gb|AJA05711.1| photosystem II protein M (plastid) [Castanea pumila var. pumila]
gb|AJA38265.1| photosystem II protein M (chloroplast) [Diospyros glaucifolia]
gb|AJA39738.1| photosystem II protein M (chloroplast) [Guadua angustifolia]
gb|AJC09129.1| PsbM (chloroplast) [Oryza sativa Indica Group]
gb|AJC09228.1| PsbM (chloroplast) [Oryza sativa Indica Group]
gb|AJC09327.1| PsbM (chloroplast) [Oryza sativa]
gb|AJC09427.1| PsbM (chloroplast) [Oryza glaberrima]
gb|AJC09527.1| PsbM (chloroplast) [Oryza barthii]
gb|AJC09627.1| PsbM (chloroplast) [Oryza rufipogon]
gb|AJC09727.1| PsbM (chloroplast) [Oryza meridionalis]
gb|AJC09827.1| PsbM (chloroplast) [Oryza glumipatula]
gb|AJC09927.1| PsbM (chloroplast) [Oryza punctata]
gb|AJC10101.1| PsbM (chloroplast) [Oryza glaberrima]
gb|AJC10201.1| PsbM (chloroplast) [Oryza barthii]
gb|AJC10301.1| PsbM (chloroplast) [Oryza barthii]
gb|AJC10401.1| PsbM (chloroplast) [Oryza barthii]
gb|AJC10501.1| PsbM (chloroplast) [Oryza barthii]
gb|AJC10601.1| PsbM (chloroplast) [Oryza sativa Indica Group]
gb|AJC99301.1| PsbM (chloroplast) [Oryza sativa Japonica Group]
gb|AJC99390.1| PsbM (chloroplast) [Oryza sativa Japonica Group]
gb|AJC99731.1| PsbM (chloroplast) [Oryza glaberrima]
gb|AJC99831.1| PsbM (chloroplast) [Oryza nivara]
gb|AJC99931.1| PsbM (chloroplast) [Oryza barthii]
gb|AJD00032.1| PsbM (chloroplast) [Oryza longistaminata]
dbj|BAQ19635.1| photosystem II protein M (chloroplast) [Ananas comosus]
gb|AJD76815.1| photosystem II protein M (chloroplast) [Lathraea squamaria]
gb|AJE28368.1| photosystem II protein M (chloroplast) [Premna microphylla]
gb|AJE71211.1| photosystem II protein M (plastid) [Acorus gramineus]
gb|AJE73083.1| photosystem II protein M (plastid) [Xanthisma spinulosum]
gb|AJE73159.1| photosystem II protein M (plastid) [Gutierrezia sarothrae]
gb|AJE73235.1| photosystem II protein M (plastid) [Liatris squarrosa]
gb|AJE73387.1| photosystem II protein M (plastid) [Erigeron strigosus]
gb|AJE73539.1| photosystem II protein M (plastid) [Cirsium undulatum]
gb|AJE73615.1| photosystem II protein M (plastid) [Solidago canadensis var.
scabra]
gb|AJE73691.1| photosystem II protein M (plastid) [Erigeron philadelphicus]
gb|AJE73767.1| photosystem II protein M (plastid) [Heterotheca stenophylla]
gb|AJE73919.1| photosystem II protein M (plastid) [Vernonia baldwinii]
gb|AJE73995.1| photosystem II protein M (plastid) [Helenium flexuosum]
gb|AJE74071.1| photosystem II protein M (plastid) [Heterotheca villosa]
gb|AJE74147.1| photosystem II protein M (plastid) [Cirsium altissimum]
gb|AJE74223.1| photosystem II protein M (plastid) [Echinacea angustifolia]
gb|AJE74299.1| photosystem II protein M (plastid) [Helianthus petiolaris]
gb|AJE74603.1| photosystem II protein M (plastid) [Ratibida columnifera]
gb|AJE74679.1| photosystem II protein M (plastid) [Lygodesmia juncea]
gb|AJE74755.1| photosystem II protein M (plastid) [Hymenopappus tenuifolius]
gb|AJE74831.1| photosystem II protein M (plastid) [Cirsium canescens]
gb|AJE74907.1| photosystem II protein M (plastid) [Solidago gigantea]
gb|AJE75059.1| photosystem II protein M (plastid) [Erigeron bellidiastrum]
gb|AJE75135.1| photosystem II protein M (plastid) [Tragopogon dubius]
gb|AJF94036.1| photosystem II protein M (chloroplast) [Diospyros sp. LHM-2015]
gb|AJF94123.1| photosystem II protein M (chloroplast) [Diospyros lotus]
gb|AJF94210.1| photosystem II protein M (chloroplast) [Diospyros oleifera]
gb|AJK90741.1| photosystem II protein M (chloroplast) [Capsicum lycianthoides]
gb|AJL34403.1| photosystem II protein M (chloroplast) [Dunalia obovata]
gb|AJM70051.1| photosystem II protein M (chloroplast) [Chloranthus japonicus]
gb|AJM70094.1| photosystem II protein M (chloroplast) [Iochroma nitidum]
gb|AJN90300.1| photosystem II protein M (plastid) [Physalis peruviana]
gb|AJN90406.1| photosystem II protein M (chloroplast) [Phyllostachys edulis]
gb|AJN90500.1| photosystem II protein M (chloroplast) [Iochroma stenanthum]
gb|AJN91009.1| photosystem II protein M (plastid) [Lithocarpus balansae]
gb|AJO25106.1| photosystem II protein M (chloroplast) [Solanum lycopersicum]
gb|AJO25283.1| PSII M protein (chloroplast) [Diplopanax stachyanthus]
gb|AJO26081.1| photosystem II protein M (chloroplast) [Actinidia chinensis]
gb|AJO26164.1| photosystem II protein M (chloroplast) [Actinidia chinensis]
gb|AJO26247.1| photosystem II protein M (chloroplast) [Actinidia deliciosa]
gb|AJO26330.1| photosystem II protein M (chloroplast) [Actinidia chinensis]
gb|AJO61575.1| photosystem II protein M (chloroplast) [Saracha punctata]
gb|AJP09557.1| photosystem II protein M (chloroplast) [Ipomoea batatas]
gb|AJP33663.1| photosystem II protein M (chloroplast) [Oryza barthii]
gb|AJP33745.1| photosystem II protein M (chloroplast) [Oryza barthii]
gb|AJP33827.1| photosystem II protein M (chloroplast) [Oryza barthii]
gb|AJP33909.1| photosystem II protein M (chloroplast) [Oryza barthii]
gb|AJP33992.1| photosystem II protein M (chloroplast) [Oryza glaberrima]
gb|AJP34073.1| photosystem II protein M (chloroplast) [Oryza glaberrima]
gb|AJP34156.1| photosystem II protein M (chloroplast) [Oryza glumipatula]
gb|AJP34239.1| photosystem II protein M (chloroplast) [Oryza longistaminata]
gb|AJP34322.1| photosystem II protein M (chloroplast) [Oryza longistaminata]
gb|AJP34405.1| photosystem II protein M (chloroplast) [Oryza officinalis]
gb|AJR30373.1| photosystem II protein M (chloroplast) [Vassobia breviflora]
gb|AJR32894.1| photosystem II protein M (chloroplast) [Dunalia spinosa]
gb|AJS14248.1| photosystem II protein M (chloroplast) [Iochroma loxense]
gb|AJS14332.1| photosystem II protein M (chloroplast) [Iochroma calycinum]
gb|AJS14413.1| photosystem II protein M (plastid) [Ruellia breedlovei]
gb|AJS14499.1| photosystem II protein M (plastid) [Iochroma australe]
gb|AJV88590.1| photosystem II protein M (chloroplast) [Carludovica palmata]
gb|AJV89101.1| photosystem II protein M (plastid) [Avena sativa]
gb|AJV89267.1| photosystem II protein M (plastid) [Brachyelytrum aristosum]
gb|AJV89604.1| photosystem II protein M (plastid) [Diarrhena obovata]
gb|AJV89853.1| photosystem II protein M (plastid) [Melica mutica]
gb|AJV89936.1| photosystem II protein M (plastid) [Melica subulata]
gb|AJV90103.1| photosystem II protein M (plastid) [Phaenosperma globosum]
gb|AJV90186.1| photosystem II protein M (plastid) [Phalaris arundinacea]
gb|AJW59573.1| photosystem II protein M (chloroplast) [Ilex dumosa]
gb|AJW59616.1| photosystem II protein M (chloroplast) [Ilex paraguariensis]
gb|AJW60142.1| photosystem II protein M (chloroplast) [Quercus aliena]
gb|AJW75044.1| photosystem II protein M (chloroplast) [Vassobia dichotoma]
gb|AJY78686.1| photosystem II protein M (chloroplast) [Solanum cheesmaniae]
gb|AJY78769.1| photosystem II protein M (chloroplast) [Solanum chilense]
gb|AJY78852.1| photosystem II protein M (chloroplast) [Solanum galapagense]
gb|AJY78935.1| photosystem II protein M (chloroplast) [Solanum habrochaites]
gb|AJY79018.1| photosystem II protein M (chloroplast) [Solanum lycopersicum]
gb|AJY79101.1| photosystem II protein M (chloroplast) [Solanum neorickii]
gb|AJY79184.1| photosystem II protein M (chloroplast) [Solanum peruvianum]
gb|AJY79267.1| photosystem II protein M (chloroplast) [Solanum pimpinellifolium]
gb|AKA66526.1| photosystem II protein M (chloroplast) [Dunalia brachyacantha]
gb|AKA66957.1| photosystem II protein M (chloroplast) [Quercus spinosa]
gb|AKB92921.1| photosystem II protein M (chloroplast) [Colchicum autumnale]
gb|AKB93007.1| photosystem II protein M (chloroplast) [Gloriosa superba]
gb|AKC05463.1| photosystem II protein M (chloroplast) [Quercus aquifolioides]
gb|AKE07330.1| photosystem II protein M (plastid) [Guadua weberbaueri]
gb|AKF00569.1| photosystem II protein M (chloroplast) [Reinhardtia paiewonskiana]
gb|AKF00832.1| photosystem II protein M (chloroplast) [Veitchia spiralis]
gb|AKF00918.1| photosystem II protein M (chloroplast) [Areca vestiaria]
gb|AKF01984.1| photosystem II protein M (chloroplast) [Manicaria saccifera]
gb|AKF33684.1| photosystem II protein M (chloroplast) [Dioscorea zingiberensis]
gb|AKF78406.1| photosystem II protein M (chloroplast) [Dunalia solanacea]
gb|AKG49782.1| photosystem II protein M (chloroplast) [Cynara humilis]
gb|AKH02193.1| photosystem II protein M (chloroplast) [Cynara cardunculus var.
scolymus]
gb|AKH02313.1| photosystem II protein M (chloroplast) [Iochroma tingoanum]
gb|AKH04419.1| photosystem II protein M (plastid) [Chusquea circinata]
gb|AKH04503.1| photosystem II protein M (plastid) [Chusquea sp. PFM-2015]
gb|AKH04587.1| photosystem II protein M (plastid) [Otatea glauca]
gb|AKH04671.1| photosystem II protein M (plastid) [Pariana campestris]
gb|AKH04754.1| photosystem II protein M (plastid) [Pariana radiciflora]
gb|AKH04837.1| photosystem II protein M (plastid) [Pariana sp. PFM-2015]
gb|AKH49622.1| photosystem II protein M (chloroplast) [Chikusichloa aquatica]
gb|AKJ25292.1| photosystem II protein M (plastid) [Carex siderosticta]
gb|AKJ76797.1| PSII M protein (chloroplast) [Salvia rosmarinus]
gb|AKJ77211.1| photosystem II M protein (chloroplast) [Scutellaria baicalensis]
gb|AKJ77478.1| photosystem II protein M (chloroplast) [Carthamus tinctorius]
gb|AKJ77557.1| photosystem II protein M (chloroplast) [Dioscorea nipponica]
gb|AKJ77638.1| photosystem II protein M (chloroplast) [Fagopyrum cymosum]
gb|AKJ77735.1| photosystem II protein M (chloroplast) [Perilla frutescens]
gb|AKJ83505.1| photosystem II protein M (chloroplast) [Dieffenbachia seguine]
gb|AKJ83761.1| photosystem II protein M (chloroplast) [Pinellia ternata]
gb|AKJ85808.1| photosystem II protein M (chloroplast) [Podococcus barteri]
gb|AKM21331.1| PSII M protein (chloroplast) [Pogostemon yatabeanus]
gb|AKM21418.1| PSII M protein (chloroplast) [Pogostemon stellatus]
gb|AKM21506.1| PSII M protein (chloroplast) [Paulownia coreana]
gb|AKM21593.1| PSII M protein (chloroplast) [Paulownia tomentosa]
gb|AKM21853.1| PsbM (chloroplast) [Solanum commersonii]
gb|AKM21939.1| PsbM (chloroplast) [Solanum nigrum]
gb|AKM22025.1| PsbM (chloroplast) [Solanum tuberosum]
gb|AKM98154.1| photosystem II M protein (chloroplast) [Anemone patens]
gb|AKM98242.1| photosystem II M protein (chloroplast) [Anemone patens]
gb|AKM98330.1| photosystem II M protein (chloroplast) [Pulsatilla pratensis]
gb|AKM98418.1| photosystem II M protein (chloroplast) [Pulsatilla pratensis]
gb|AKM98506.1| photosystem II M protein (chloroplast) [Pulsatilla vernalis]
gb|AKM98594.1| photosystem II M protein (chloroplast) [Pulsatilla vernalis]
gb|AKQ49257.1| photosystem II protein M (chloroplast) [Cynara cardunculus var.
altilis]
gb|AKQ49344.1| photosystem II protein M (chloroplast) [Cynara cardunculus var.
altilis]
gb|AKQ49431.1| photosystem II protein M (chloroplast) [Cynara baetica]
gb|AKQ49518.1| photosystem II protein M (chloroplast) [Cynara cornigera]
gb|AKQ49605.1| photosystem II protein M (chloroplast) [Cynara cardunculus var.
scolymus]
gb|AKQ49692.1| photosystem II protein M (chloroplast) [Cynara cardunculus var.
scolymus]
gb|AKQ49779.1| photosystem II protein M (chloroplast) [Cynara cardunculus var.
scolymus]
gb|AKQ49866.1| photosystem II protein M (chloroplast) [Cynara cardunculus var.
scolymus]
gb|AKQ49953.1| photosystem II protein M (chloroplast) [Cynara cardunculus var.
scolymus]
gb|AKQ50040.1| photosystem II protein M (chloroplast) [Cynara cardunculus var.
scolymus]
gb|AKQ50127.1| photosystem II protein M (chloroplast) [Cynara cardunculus var.
sylvestris]
gb|AKQ50214.1| photosystem II protein M (chloroplast) [Cynara cardunculus var.
sylvestris]
gb|AKQ50301.1| photosystem II protein M (chloroplast) [Cynara cardunculus var.
sylvestris]
gb|AKQ50388.1| photosystem II protein M (chloroplast) [Cynara cardunculus var.
sylvestris]
gb|AKQ50475.1| photosystem II protein M (chloroplast) [Cynara cardunculus var.
sylvestris]
gb|AKQ50562.1| photosystem II protein M (chloroplast) [Cynara cardunculus var.
sylvestris]
gb|AKQ50649.1| photosystem II protein M (chloroplast) [Cynara cardunculus var.
sylvestris]
gb|AKQ50736.1| photosystem II protein M (chloroplast) [Cynara cardunculus var.
sylvestris]
gb|AKQ50823.1| photosystem II protein M (chloroplast) [Cynara syriaca]
gb|AKQ51153.1| photosystem II protein M (plastid) [Borassus flabellifer]
gb|AKR06841.1| photosystem II protein M (chloroplast) [Carnegiea gigantea]
gb|AKR80586.1| photosystem II protein M (plastid) [Sararanga sinuosa]
gb|AKR80709.1| photosystem II protein M (plastid) [Croomia japonica]
gb|AKR80809.1| photosystem II protein M (plastid) [Xerophyta retinervis]
gb|AKR80991.1| photosystem II protein M (plastid) [Stichoneuron caudatum]
gb|AKR81062.1| photosystem II protein M (plastid) [Pentastemona sumatrana]
gb|AKR81185.1| photosystem II protein M (plastid) [Freycinetia banksii]
gb|AKR81222.1| photosystem II protein M (plastid) [Cyclanthus bipartitus]
gb|AKS28765.1| photosystem II protein M (chloroplast) [Capsella rubella]
gb|AKT93688.1| photosystem II protein M (chloroplast) [Rheum palmatum]
gb|AKU47126.1| photosystem II protein M (chloroplast) [Ananas comosus]
gb|AKU47244.1| photosystem II protein M (chloroplast) [Capsella grandiflora]
gb|AKZ23246.1| photosystem II protein M (plastid) [Carduus nutans]
gb|AKZ23247.1| photosystem II protein M (plastid) [Vernonia baldwinii]
gb|AKZ23248.1| photosystem II protein M (plastid) [Helianthus pauciflorus subsp.
subrhomboideus]
gb|AKZ23249.1| photosystem II protein M (plastid) [Helianthus tuberosus]
gb|AKZ23250.1| photosystem II protein M (plastid) [Rudbeckia hirta var.
pulcherrima]
gb|AKZ23251.1| photosystem II protein M (plastid) [Silphium integrifolium]
gb|AKZ23252.1| photosystem II protein M (plastid) [Heliopsis helianthoides var.
occidentalis]
gb|AKZ23253.1| photosystem II protein M (plastid) [Grindelia squarrosa var.
squarrosa]
gb|AKZ23254.1| photosystem II protein M (plastid) [Solidago missouriensis]
gb|AKZ23258.1| photosystem II protein M (plastid) [Symphoricarpos occidentalis]
gb|AKZ23260.1| photosystem II protein M (plastid) [Physalis heterophylla]
gb|AKZ23261.1| photosystem II protein M (plastid) [Physalis virginiana]
gb|AKZ23262.1| photosystem II protein M (plastid) [Solanum carolinense]
gb|AKZ23263.1| photosystem II protein M (plastid) [Solanum rostratum]
gb|AKZ23264.1| photosystem II protein M (plastid) [Solanum triflorum]
gb|AKZ23265.1| photosystem II protein M (plastid) [Monarda fistulosa var. mollis]
gb|AKZ23266.1| photosystem II protein M (plastid) [Salvia nemorosa]
gb|AKZ23267.1| photosystem II protein M (plastid) [Nepeta cataria]
gb|AKZ23272.1| photosystem II protein M (plastid) [Verbena hastata]
gb|AKZ23273.1| photosystem II protein M (plastid) [Veronica americana]
gb|AKZ23275.1| photosystem II protein M (plastid) [Convolvulus arvensis]
gb|AKZ23276.1| photosystem II protein M (plastid) [Ipomoea leptophylla]
gb|AKZ23277.1| photosystem II protein M (plastid) [Evolvulus nuttallianus]
gb|AKZ23281.1| photosystem II protein M (plastid) [Silene antirrhina]
gb|AKZ23282.1| photosystem II protein M (plastid) [Silene vulgaris]
gb|AKZ30106.1| photosystem II protein M (chloroplast) [Selliera radicans]
gb|AKZ30165.1| photosystem II protein M (chloroplast) [Velleia rosea]
gb|AKZ30231.1| photosystem II protein M (chloroplast) [Goodenia helmsii]
gb|AKZ30363.1| photosystem II protein M (chloroplast) [Goodenia hassallii]
gb|AKZ30429.1| photosystem II protein M (chloroplast) [Goodenia pinifolia]
gb|AKZ30496.1| photosystem II protein M (chloroplast) [Goodenia viscida]
gb|AKZ30562.1| photosystem II protein M (chloroplast) [Velleia discophora]
gb|AKZ30628.1| photosystem II protein M (chloroplast) [Goodenia drummondii]
gb|AKZ30694.1| photosystem II protein M (chloroplast) [Velleia foliosa]
gb|AKZ30827.1| photosystem II protein M (chloroplast) [Goodenia tripartita]
gb|AKZ30955.1| photosystem II protein M (chloroplast) [Goodenia filiformis]
gb|AKZ31089.1| photosystem II protein M (chloroplast) [Goodenia decursiva]
gb|AKZ31156.1| photosystem II protein M (chloroplast) [Scaevola collaris]
gb|AKZ31214.1| photosystem II protein M (chloroplast) [Goodenia micrantha]
gb|AKZ31350.1| photosystem II protein M (chloroplast) [Coopernookia polygalacea]
gb|AKZ31416.1| photosystem II protein M (chloroplast) [Coopernookia strophiolata]
gb|AKZ31480.1| photosystem II protein M (chloroplast) [Verreauxia reinwardtii]
gb|AKZ31546.1| photosystem II protein M (chloroplast) [Goodenia phillipsiae]
gb|ALB38577.1| photosystem II protein M (chloroplast) [Epipremnum aureum]
gb|ALB78253.1| photosystem II protein M (chloroplast) [Tanaecium tetragonolobum]
gb|ALD50097.1| PsbM (chloroplast) [Capsicum annuum var. glabriusculum]
gb|ALD50183.1| PsbM (chloroplast) [Capsicum frutescens]
gb|ALD50269.1| PsbM (chloroplast) [Capsicum annuum var. annuum]
gb|ALD50355.1| PsbM (chloroplast) [Capsicum baccatum var. baccatum]
gb|ALE28961.1| photosystem II protein M (plastid) [Colpothrinax cookii]
gb|ALF35924.1| photosystem II protein M (chloroplast) [Oryza sativa aromatic
subgroup]
gb|ALF36001.1| photosystem II protein M (chloroplast) [Oryza sativa tropical
japonica subgroup]
gb|ALF99697.1| photosystem II protein M (chloroplast) [Colobanthus quitensis]
gb|ALI31134.1| photosystem II protein M (chloroplast) [Solanum nigrum]
gb|ALI91923.1| PsbM (chloroplast) [Apodytes dimidiata]
gb|ALI91925.1| PsbM (chloroplast) [Cassinopsis madagascariensis]
gb|ALI91926.1| PsbM (chloroplast) [Cordia sebestena]
gb|ALI91928.1| PsbM (chloroplast) [Discophora guianensis]
gb|ALI91929.1| PsbM (chloroplast) [Emmotum nitens]
gb|ALI91930.1| PsbM (chloroplast) [Garrya flavescens]
gb|ALI91932.1| PsbM (chloroplast) [Hydrolea corymbosa]
gb|ALI91943.1| PsbM (chloroplast) [Oncotheca balansae]
gb|ALI91945.1| PsbM (chloroplast) [Platea latifolia]
gb|ALI91946.1| PsbM (chloroplast) [Polypremum procumbens]
gb|ALI91955.1| PsbM (chloroplast) [Sphenoclea zeylanica]
gb|ALI91957.1| PsbM (chloroplast) [Vahlia capensis]
gb|ALJ49590.1| photosystem II protein M (chloroplast) [Pseudosasa japonica]
gb|ALJ49667.1| photosystem II protein M (chloroplast) [Pseudosasa japonica]
gb|ALJ78244.1| photosystem II protein M (plastid) [Plantago maritima]
gb|ALJ78340.1| photosystem II protein M (plastid) [Plantago media]
gb|ALK00672.1| PsbM (chloroplast) [Oryza glumipatula]
gb|ALK00777.1| PsbM (chloroplast) [Oryza glumipatula]
gb|ALK26610.1| photosystem II protein M (chloroplast) [Ostrya rehderiana]
gb|ALL53067.1| photosystem II protein M (chloroplast) [Bletilla striata]
gb|ALL97035.1| photosystem II protein M (chloroplast) [Musa balbisiana]
gb|ALN11567.1| photosystem II protein M (chloroplast) [Iochroma edule]
gb|ALN11597.1| photosystem II protein M (chloroplast) [Scutellaria insignis]
gb|ALN98165.1| photosystem II protein M (chloroplast) [Dendrobium chrysotoxum]
gb|ALP83540.1| photosystem II protein M (chloroplast) [Curcuma flaviflora]
gb|ALS20006.1| photosystem II protein M (chloroplast) [Metanarthecium luteoviride]
gb|ALT06370.1| photosystem II protein M (chloroplast) [Guadua chacoensis]
gb|ALT06454.1| photosystem II protein M (chloroplast) [Merostachys sp. Greco 18]
gb|ALT14466.1| photosystem II protein M (chloroplast) [Nicotiana otophora]
gb|ALT55444.1| photosystem II protein M (chloroplast) [Syagrus coronata]
gb|ALV25562.1| photosystem II protein M (chloroplast) [Aletris spicata]
gb|ALV25646.1| photosystem II protein M (chloroplast) [Aletris fauriei]
emb|CUA65568.1| photosystem II protein M (chloroplast) [Capsella rubella]
emb|CUA65652.1| photosystem II protein M (chloroplast) [Camelina sativa]
gb|ALV90222.1| photosystem II protein M (chloroplast) [Silene latifolia subsp.
alba]
gb|ALV90303.1| photosystem II protein M (chloroplast) [Silene latifolia subsp.
alba]
gb|ALZ50011.1| PSII M protein (chloroplast) [Abeliophyllum distichum]
gb|ALZ50098.1| PSII low MW protein M (chloroplast) [Coreanomecon hylomeconoides]
gb|AMB20966.1| photosystem II protein M (chloroplast) [Oryza minuta]
gb|AMC31872.1| photosystem II protein M (chloroplast) [Capsella bursa-pastoris]
gb|AMC31883.1| photosystem II protein M (chloroplast) [Lepidium densiflorum]
gb|AMC31887.1| photosystem II protein M (chloroplast) [Oxalis dillenii]
gb|AMC31889.1| photosystem II protein M (chloroplast) [Physaria ludoviciana]
gb|AMD07888.1| photosystem II protein M (chloroplast) [Diospyros kaki]
gb|AMD08098.1| photosystem II protein M (chloroplast) [Akebia trifoliata]
gb|AMD08267.1| photosystem II protein M (chloroplast) [Euptelea pleiosperma]
gb|AMD08352.1| photosystem II protein M (chloroplast) [Meliosma aff. cuneifolia
Moore 333]
gb|AMD08521.1| photosystem II protein M (chloroplast) [Stephania japonica]
gb|AMD08606.1| photosystem II protein M (chloroplast) [Pachysandra terminalis]
gb|AMH85868.1| photosystem II protein M (chloroplast) [Quercus baronii]
gb|AMK97312.1| psbM (chloroplast) [Drosera rotundifolia]
gb|AML26895.1| photosystem II protein M (chloroplast) [Monsonia emarginata]
gb|AMM05537.1| photosystem II protein M (plastid) [Nicotiana tabacum]
gb|AMN14339.1| photosystem II protein M (chloroplast) [Utricularia reniformis]
gb|AMP19570.1| photosystem II protein M (chloroplast) [Iochroma cardenasianum]
gb|AMQ13314.1| photosystem II protein M (plastid) [Tofieldia thibetica]
gb|AMQ13399.1| photosystem II protein M (plastid) [Potamogeton perfoliatus]
gb|AMQ13484.1| photosystem II protein M (plastid) [Sagittaria lichuanensis]
gb|AMQ32854.1| photosystem II protein M (chloroplast) [Stenogyne haliakalae]
gb|AMQ32942.1| photosystem II protein M (chloroplast) [Phyllostegia waimeae]
gb|AMQ33030.1| photosystem II protein M (chloroplast) [Stenogyne bifida]
gb|AMQ33118.1| photosystem II protein M (chloroplast) [Haplostachys haplostachya]
gb|AMQ33206.1| photosystem II protein M (chloroplast) [Phyllostegia velutina]
gb|AMQ33382.1| photosystem II protein M (chloroplast) [Stenogyne kanehoana]
gb|AMQ33470.1| photosystem II protein M (chloroplast) [Haplostachys linearifolia]
gb|AMQ33558.1| photosystem II protein M (chloroplast) [Stachys chamissonis]
gb|AMQ33646.1| photosystem II protein M (chloroplast) [Stachys coccinea]
gb|AMQ33734.1| photosystem II protein M (chloroplast) [Stachys sylvatica]
gb|AMQ33822.1| photosystem II protein M (chloroplast) [Stachys byzantina]
gb|AMQ33923.1| photosystem II protein M (chloroplast) [Helianthus petiolaris
subsp. fallax]
gb|AMQ99368.1| photosystem II M protein (chloroplast) [Aconitum chiisanense]
gb|AMR00384.1| photosystem II protein M (chloroplast) [Iochroma australe]
gb|AMR73816.1| photosystem II M protein (chloroplast) [Kolkwitzia amabilis]
gb|AMR74102.1| PsbM (chloroplast) [Perilla frutescens]
gb|AMR74190.1| PsbM (chloroplast) [Perilla frutescens var. acuta]
gb|AMR74278.1| PsbM (chloroplast) [Perilla frutescens f. crispidiscolor]
gb|AMR74366.1| PsbM (chloroplast) [Perilla frutescens var. crispa]
gb|AMR74454.1| PsbM (chloroplast) [Perilla frutescens var. crispa]
gb|AMR74542.1| PsbM (chloroplast) [Perilla frutescens var. frutescens]
gb|AMR74630.1| PsbM (chloroplast) [Perilla citriodora]
gb|AMR74718.1| PsbM (chloroplast) [Perilla frutescens var. hirtella]
gb|AMR74806.1| PsbM (chloroplast) [Perilla setoyensis]
gb|AMV74052.1| photosystem II protein M (plastid) [Iochroma lehmannii]
gb|AMW65026.1| photosystem II protein M (chloroplast) [Mauritia flexuosa]
gb|AMW65112.1| photosystem II protein M (plastid) [Caryota mitis]
gb|AMW65198.1| photosystem II protein M (plastid) [Wallichia densiflora]
gb|AMW65283.1| photosystem II protein M (plastid) [Veitchia arecina]
gb|AMW65369.1| photosystem II protein M (plastid) [Trithrinax brasiliensis]
gb|AMW65456.1| photosystem II protein M (plastid) [Tahina spectabilis]
gb|AMW65535.1| photosystem II protein M (plastid) [Serenoa repens]
gb|AMW65707.1| photosystem II protein M (plastid) [Pritchardia thurstonii]
gb|AMW65793.1| photosystem II protein M (plastid) [Pigafetta elata]
gb|AMW65880.1| photosystem II protein M (plastid) [Phytelephas aequatorialis]
gb|AMW65966.1| photosystem II protein M (plastid) [Nypa fruticans]
gb|AMW66052.1| photosystem II protein M (plastid) [Metroxylon warburgii]
gb|AMW66138.1| photosystem II protein M (plastid) [Lodoicea maldivica]
gb|AMW66224.1| photosystem II protein M (plastid) [Licuala paludosa]
gb|AMW66310.1| photosystem II protein M (plastid) [Leucothrinax morrisii]
gb|AMW66396.1| photosystem II protein M (plastid) [Hanguana malayana]
gb|AMW66482.1| photosystem II protein M (plastid) [Eugeissona tristis]
gb|AMW66564.1| photosystem II protein M (plastid) [Eremospatha macrocarpa]
gb|AMW66650.1| photosystem II protein M (plastid) [Corypha lecomtei]
gb|AMW66736.1| photosystem II protein M (plastid) [Chuniophoenix nana]
gb|AMW66822.1| photosystem II protein M (plastid) [Chamaerops humilis]
gb|AMW66908.1| photosystem II protein M (plastid) [Brahea brandegeei]
gb|AMW66994.1| photosystem II protein M (plastid) [Borassodendron machadonis]
gb|AMW67080.1| photosystem II protein M (plastid) [Baxteria australis]
gb|AMW67166.1| photosystem II protein M (plastid) [Arenga caudata]
gb|AMW67252.1| photosystem II protein M (plastid) [Areca vestiaria]
gb|AMW67331.1| photosystem II protein M (plastid) [Acoelorraphe wrightii]
gb|AMW67417.1| photosystem II protein M (plastid) [Washingtonia robusta]
gb|AMX21457.1| photosystem II protein M (chloroplast) [Helianthus praecox]
gb|AMX21591.1| photosystem II protein M (chloroplast) [Iochroma grandiflorum]
gb|AMX21682.1| photosystem II protein M (chloroplast) [Iochroma parvifolium]
gb|AMX22330.1| photosystem II protein M (chloroplast) [Helianthus petiolaris]
gb|AMX23152.1| photosystem II protein M (chloroplast) [Solanum melongena]
gb|AMX23231.1| photosystem II protein M (plastid) [Ananas comosus]
gb|AMY95752.1| photosystem II protein M (chloroplast) [Iochroma umbellatum]
gb|AMY95987.1| photosystem II protein M (plastid) [Geranium incanum]
gb|ANA07551.1| photosystem II protein M (chloroplast) [Acnistus arborescens x
Iochroma cyaneum]
gb|ANA10808.1| photosystem II protein M (chloroplast) [Cabomba caroliniana]
gb|ANA56572.1| photosystem II protein M (plastid) [Annona cherimola]
gb|ANA56680.1| photosystem II protein M (chloroplast) [Iochroma lehmannii]
gb|ANA56795.1| photosystem II protein M (chloroplast) [Iochroma salpoanum]
gb|ANA57528.1| photosystem II protein M (plastid) [Veronica nakaiana]
gb|ANA57616.1| photosystem II protein M (plastid) [Veronica persica]
gb|ANA57702.1| photosystem II protein M (plastid) [Veronicastrum sibiricum]
gb|ANA91059.1| photosystem II protein M (chloroplast) [Eriolarynx fasciculata]
gb|ANA91194.1| photosystem II protein M (chloroplast) [Helianthus debilis]
gb|ANB44477.1| photosystem II protein M (chloroplast) [Iochroma ellipticum]
gb|ANB44561.1| photosystem II protein M (chloroplast) [Iochroma cyaneum]
gb|ANB78716.1| photosystem II protein M (chloroplast) [Bruinsmia polysperma]
gb|ANB78980.1| photosystem II protein M (chloroplast) [Helianthus annuus subsp.
texanus]
gb|ANC49166.1| photosystem II protein M (chloroplast) [Acnistus arborescens]
gb|ANC62757.1| PsbM (plastid) [Solanum melongena]
gb|ANC62909.1| photosystem II protein M (chloroplast) [Erythranthe lutea]
gb|ANC95050.1| photosystem II protein M (chloroplast) [Dunalia spathulata]
gb|ANC95229.1| photosystem II protein M (plastid) [Iochroma gesnerioides]
gb|ANC95361.1| photosystem II protein M (chloroplast) [Iochroma cyaneum]
gb|ANC96372.1| photosystem II protein M (chloroplast) [Iochroma albianthum]
gb|AND96964.1| PSII M protein (chloroplast) [Cornus controversa]
gb|ANE11136.1| photosystem II protein M (plastid) [Ananas comosus]
gb|ANE20275.1| photosystem II protein M (plastid) [Iochroma confertiflorum]
gb|ANF03653.1| photosystem II protein M (chloroplast) [Helianthus argophyllus]
gb|ANF03885.1| photosystem II protein M (plastid) [Helianthus annuus]
gb|ANF05207.1| photosystem II protein M (chloroplast) [Scopolia parviflora]
gb|ANG07764.1| PSII low MW protein M (chloroplast) [Neofinetia falcata]
gb|ANG07838.1| PSII low MW protein M (chloroplast) [Neofinetia richardsiana]
gb|ANG07912.1| PSII low MW protein M (chloroplast) [Neofinetia falcata]
gb|ANG08098.1| photosystem II protein M (chloroplast) [Lychnis wilfordii]
gb|ANG08181.1| photosystem II protein M (chloroplast) [Silene capitata]
gb|ANG44664.1| photosystem II protein M (chloroplast) [Oryza sativa Indica Group]
emb|CZF94795.1| PSII low MW protein (chloroplast) [Arabidopsis suecica]
emb|CZF94880.1| PSII low MW protein (chloroplast) [Arabidopsis suecica]
emb|CZF94965.1| PSII low MW protein (chloroplast) [Arabidopsis suecica]
gb|ANJ03951.1| PsbM (chloroplast) [Capsicum chinense]
gb|ANJ04267.1| photosystem II protein M (plastid) [Castilleja paramensis]
gb|ANJ04384.1| photosystem II M protein (chloroplast) [Aconitum kusnezoffii]
gb|ANJ04467.1| photosystem II M protein (chloroplast) [Gymnaconitum gymnandrum]
gb|ANJ04550.1| photosystem II M protein (chloroplast) [Aconitum barbatum var.
puberulum]
gb|ANJ59888.1| photosystem II protein M (chloroplast) [Nymphaea jamesoniana]
gb|ANJ78498.1| photosystem II protein M (chloroplast) [Oryza brachyantha]
gb|ANN44724.1| photosystem II protein M (chloroplast) [Liriodendron chinense]
gb|ANO44348.1| photosystem II protein M (chloroplast) [Nymphaea ampla]
gb|ANO44529.1| photosystem II protein M (chloroplast) [Alstroemeria longistaminea]
gb|ANO44652.1| photosystem II protein M (chloroplast) [Bomarea sp. 878]
gb|ANO44835.1| photosystem II protein M (chloroplast) [Philesia magellanica]
gb|ANO44957.1| photosystem II protein M (chloroplast) [Uvularia grandiflora]
gb|ANO45016.1| photosystem II protein M (chloroplast) [Uvularia sessiliflora]
gb|ANO45075.1| photosystem II protein M (chloroplast) [Wurmbea pygmaea]
gb|ANO45243.1| photosystem II protein M (chloroplast) [Lapageria rosea]
gb|ANO45482.1| photosystem II protein M (chloroplast) [Burchardia umbellata]
gb|ANO45542.1| photosystem II protein M (chloroplast) [Ripogonum album]
gb|ANO45603.1| photosystem II protein M (chloroplast) [Prosartes lanuginosa]
gb|ANO45664.1| photosystem II protein M (chloroplast) [Petermannia cirrosa]
gb|ANP25490.1| PSII M protein (chloroplast) [Eucommia ulmoides]
gb|ANP25595.1| photosystem II protein M (chloroplast) [Schisandra chinensis]
gb|ANP25679.1| photosystem II protein M (chloroplast) [Quercus edithiae]
gb|ANP26012.1| PSII M protein (chloroplast) [Hypolytrum nemorum]
gb|ANQ38731.1| photosystem II protein M (plastid) [Bergbambos tessellata]
gb|ANQ38813.1| photosystem II protein M (plastid) [Fargesia nitida]
gb|ANQ39007.1| photosystem II protein M (plastid) [Oldeania alpina]
gb|ANQ39091.1| photosystem II protein M (plastid) [Phyllostachys aurea]
gb|ANQ39219.1| photosystem II protein M (plastid) [Sasa veitchii]
gb|ANQ46319.1| psbM (chloroplast) [Pogostemon cablin]
gb|ANS11078.1| photosystem II protein M (plastid) [Chimonocalamus sp. Clark &
Reiners s.n.]
gb|ANS11161.1| photosystem II protein M (plastid) [Shibataea kumasaca]
gb|ANS57509.1| photosystem II protein M (chloroplast) [Nymphaea alba]
gb|ANS71675.1| PSII M protein (chloroplast) [Carex neurocarpa]
gb|ANS80720.1| photosystem II protein M (chloroplast) [Ilex latifolia]
gb|ANS80815.1| photosystem II protein M (chloroplast) [Ilex szechwanensis]
gb|ANS80910.1| photosystem II protein M (chloroplast) [Ilex pubescens]
gb|ANS81005.1| photosystem II protein M (chloroplast) [Ilex polyneura]
gb|ANS81100.1| photosystem II protein M (chloroplast) [Ilex sp. XY-2016]
gb|ANS81195.1| photosystem II protein M (chloroplast) [Ilex delavayi]
gb|ANS81290.1| photosystem II protein M (chloroplast) [Ilex wilsonii]
gb|ANT72464.1| photosystem II protein M (chloroplast) [Cephalanthera longifolia]
gb|ANT72552.1| photosystem II protein M (chloroplast) [Epipactis mairei]
gb|ANT72747.1| photosystem II protein M (chloroplast) [Epipactis veratrifolia]
gb|ANT72863.1| photosystem II protein M (chloroplast) [Neottia pinetorum]
gb|ANT72948.1| photosystem II protein M (chloroplast) [Listera fugongensis]
gb|ANT73034.1| photosystem II protein M (chloroplast) [Neottia ovata]
gb|ANU80148.1| PSII low MW protein M (chloroplast) [Averrhoa carambola]
gb|ANU80297.1| photosystem II M protein (chloroplast) [Aconitum carmichaelii]
gb|ANV27748.1| PsbM (chloroplast) [Aconitum coreanum]
gb|ANW06554.1| photosystem II protein M (chloroplast) [Ampelocalamus naibunensis]
gb|ANW36487.1| photosystem II protein M (chloroplast) [Quercus aliena]
gb|ANW36573.1| photosystem II protein M (chloroplast) [Quercus aliena var.
acutiserrata]
gb|ANW36659.1| photosystem II protein M (chloroplast) [Quercus variabilis]
gb|ANW36745.1| photosystem II protein M (chloroplast) [Quercus dolicholepis]
gb|ANW36902.1| photosystem II protein M (chloroplast) [Amaranthus hypochondriacus]
gb|ANW47784.1| photosystem II protein M (chloroplast) [Arabidopsis thaliana]
gb|ANW47949.1| PsbM (chloroplast) [Eclipta prostrata]
gb|ANX10378.1| photosystem II protein M (plastid) [Kuruna densifolia]
gb|ANY59800.1| PsbM (chloroplast) [Aconitum volubile]
gb|ANY60334.1| photosystem II protein M (chloroplast) [Averrhoa carambola]
gb|ANZ53268.1| PSII low MW protein M (chloroplast) [Carissa macrocarpa]
dbj|BAV56628.1| photosystem II protein M (chloroplast) [Ipomoea nil]
gb|AON77181.1| photosystem II protein M (chloroplast) [Actinidia polygama]
gb|AON77264.1| photosystem II protein M (chloroplast) [Actinidia tetramera]
gb|AON77281.1| photosystem II protein M (chloroplast) [Clematoclethra scandens
subsp. hemsleyi]
gb|AOP19380.1| photosystem II protein M (chloroplast) [Helwingia himalaica]
gb|AOQ76916.1| photosystem II protein M (chloroplast) [Davidia involucrata]
gb|AOR40733.1| photosystem II protein M (chloroplast) [Streptochaeta spicata]
gb|AOR40816.1| photosystem II protein M (chloroplast) [Leptaspis banksii]
gb|AOR40891.1| photosystem II protein M (chloroplast) [Leptaspis zeylanica]
gb|AOS52953.1| photosystem II M protein (chloroplast) [Aconitum austrokoreense]
gb|AOS85817.1| photosystem II proteinM (chloroplast) [Aconitum barbatum var.
hispidum]
gb|AOS85902.1| photosystem II proteinM (chloroplast) [Aconitum ciliare]
gb|AOS85988.1| photosystem II proteinM (chloroplast) [Aconitum coreanum]
gb|AOS86073.1| photosystem II proteinM (chloroplast) [Aconitum jaluense subsp.
jaluense]
gb|AOS86158.1| photosystem II proteinM (chloroplast) [Aconitum jaluense subsp.
jaluense]
gb|AOS86243.1| photosystem II proteinM (chloroplast) [Aconitum japonicum subsp.
napiforme]
gb|AOS86328.1| photosystem II proteinM (chloroplast) [Aconitum kusnezoffii]
gb|AOS86413.1| photosystem II proteinM (chloroplast) [Aconitum monanthum]
gb|AOS86739.1| photosystem II protein M (chloroplast) [Joinvillea ascendens]
gb|AOV63471.1| PsbM (chloroplast) [Avena sterilis]
gb|AOV63576.1| photosystem II protein M (chloroplast) [Ranunculus occidentalis]
gb|AOW32199.1| photosystem II M protein (chloroplast) [Mentha longifolia]
gb|AOW68888.1| photosystem II protein M (chloroplast) [Ranunculus austro-oreganus]
gb|AOX12913.1| photosystem II protein M (chloroplast) [Cocos nucifera]
gb|AOX13123.1| photosystem II protein M (chloroplast) [Fagopyrum tataricum]
gb|AOX22859.1| photosystem II protein M (chloroplast) [Mikania micrantha]
gb|AOY40696.1| photosystem II protein M (chloroplast) [Trollius chinensis]
gb|AOY41521.1| photosystem II protein M (chloroplast) [Haberlea rhodopensis]
gb|AOY41698.1| photosystem II protein M (chloroplast) [Galinsoga quadriradiata]
gb|APA17499.1| photosystem II protein M (chloroplast) [Dracocephalum palmatum]
gb|APA19113.1| photosystem II protein M (plastid) [Alniphyllum eberhardtii]
gb|APB91773.1| photosystem II protein M (chloroplast) [Victoria cruziana]
gb|APD83324.1| photosystem II protein M (chloroplast) [Carthamus tinctorius]
gb|APH08476.1| photosystem II protein M (chloroplast) [Amaranthus tricolor]
gb|APO11209.1| photosystem II protein M (chloroplast) [Albuca kirkii]
gb|APO15241.1| photosystem II protein M (chloroplast) [Cistanthe longiscapa]
gb|APS85500.1| PSII low MW protein M (chloroplast) [Pouteria campechiana]
gb|APS85585.1| PSII low MW protein M (chloroplast) [Diospyros blancoi]
gb|APS87140.1| photosystem II protein M (chloroplast) [Carpinus putoensis]
gb|APT41629.1| PsbM (chloroplast) [Capsicum galapagoense]
gb|APT41716.1| PsbM (chloroplast) [Capsicum chinense]
gb|APT41803.1| PsbM (chloroplast) [Capsicum chacoense]
gb|APT41890.1| PsbM (chloroplast) [Capsicum tovarii]
gb|APT41977.1| PsbM (chloroplast) [Capsicum eximium]
gb|APT42314.1| PSII M protein (chloroplast) [Rehmannia chingii]
gb|APU52702.1| photosystem II protein M (chloroplast) [Castanea henryi]
gb|APY18817.1| photosystem II protein M (chloroplast) [Akebia quinata]
gb|APZ75461.1| photosystem II reaction center M protein (chloroplast) [Saussurea
chabyoungsanica]
gb|APZ83133.1| photosystem II protein M (chloroplast) [Symplocarpus renifolius]
gb|AQM37955.1| photosystem II protein M (chloroplast) [Betula nana]
gb|AQM51584.1| photosystem II protein M (chloroplast) [Quercus aquifolioides]
gb|AQM51670.1| photosystem II protein M (chloroplast) [Quercus spinosa]
gb|AQS79778.1| photosystem II protein M (chloroplast) [Utricularia foliosa]
gb|AQU12886.1| PSII M protein (chloroplast) [Camellia huana]
gb|AQU12973.1| PSII M protein (chloroplast) [Camellia liberofilamenta]
gb|AQU13060.1| PSII M protein (chloroplast) [Camellia luteoflora]
gb|AQU14220.1| photosystem II protein M (chloroplast) [Leersia perrieri]
gb|AQU64718.1| photosystem II protein M (chloroplast) [Camptotheca acuminata]
gb|AQU64803.1| photosystem II protein M (chloroplast) [Davidia involucrata]
gb|AQU64890.1| photosystem II protein M (chloroplast) [Nyssa sinensis]
gb|AQV10534.1| photosystem II protein M (chloroplast) [Camelina sativa]
gb|AQV10596.1| PSII low MW protein (chloroplast) [Lepidium meyenii]
gb|AQV10706.1| photosystem II protein M (chloroplast) [Tarenaya hassleriana]
gb|AQV11189.1| photosystem II protein M (chloroplast) [Tillandsia usneoides]
gb|AQW41572.1| photosystem II protein M (chloroplast) [Fagus engleriana]
gb|AQW41660.1| photosystem II protein M (chloroplast) [Quercus glauca]
gb|AQX33518.1| photosystem II protein M (chloroplast) [Pityopsis falcata]
gb|AQY15691.1| photosystem II protein M (chloroplast) [Ostrya trichocarpa]
gb|AQY55949.1| PsbM (chloroplast) [Aconitum austrokoreense]
gb|AQY56035.1| PsbM (chloroplast) [Aconitum carmichaelii]
gb|AQY56122.1| PsbM (chloroplast) [Aconitum longecassidatum]
gb|AQY56209.1| PsbM (chloroplast) [Aconitum pseudolaeve]
gb|AQZ40555.1| PSII M protein (chloroplast) [Rehmannia glutinosa]
gb|AQZ40642.1| PSII M protein (chloroplast) [Rehmannia henryi]
gb|AQZ40730.1| PSII M protein (chloroplast) [Rehmannia solanifolia]
gb|AQZ40817.1| PSII M protein (chloroplast) [Rehmannia piasezkii]
gb|AQZ40904.1| PSII M protein (chloroplast) [Rehmannia elata]
gb|ARB02605.1| photosystem II protein M (chloroplast) [Schisandra sphenanthera]
gb|ARB02776.1| photosystem II protein M (plastid) [Echinacea paradoxa]
gb|ARB02861.1| photosystem II protein M (plastid) [Echinacea pallida]
gb|ARB02946.1| photosystem II protein M (plastid) [Echinacea laevigata]
gb|ARB03031.1| photosystem II protein M (plastid) [Echinacea atrorubens]
gb|ARB03116.1| photosystem II protein M (plastid) [Echinacea angustifolia]
gb|ARB03201.1| photosystem II protein M (plastid) [Echinacea speciosa]
gb|ARB03286.1| photosystem II protein M (plastid) [Echinacea tennesseensis]
gb|ARB03371.1| photosystem II protein M (plastid) [Echinacea purpurea]
gb|ARB03456.1| photosystem II protein M (plastid) [Echinacea sanguinea]
gb|ARF05972.1| photosystem II protein M (chloroplast) [Lysionotus pauciflorus]
gb|ARH02852.1| PsbM (chloroplast) [Diplostephium alveolatum]
gb|ARH03107.1| PsbM (chloroplast) [Archibaccharis asperifolia]
gb|ARH03277.1| PsbM (chloroplast) [Oritrophium peruvianum]
gb|ARH03532.1| PsbM (chloroplast) [Baccharis genistelloides]
gb|ARH03956.1| PsbM (chloroplast) [Heterothalamus alienus]
gb|ARH04126.1| PsbM (chloroplast) [Diplostephium sp. CAJ2]
gb|ARH04296.1| PsbM (chloroplast) [Laestadia muscicola]
gb|ARH04381.1| PsbM (chloroplast) [Diplostephium rhomboidale]
gb|ARH04466.1| PsbM (chloroplast) [Diplostephium tenuifolium]
gb|ARH04551.1| PsbM (chloroplast) [Diplostephium colombianum]
gb|ARH04721.1| PsbM (chloroplast) [Diplostephium revolutum]
gb|ARH04976.1| PsbM (chloroplast) [Exostigma notobellidiastrum]
gb|ARH05061.1| PsbM (chloroplast) [Diplostephium rupestre]
gb|ARH05316.1| PsbM (chloroplast) [Diplostephium rhododendroides]
gb|ARH05401.1| PsbM (chloroplast) [Blakiella bartsiifolia]
gb|ARH05571.1| PsbM (chloroplast) [Baccharis tricuneata]
gb|ARH05656.1| PsbM (chloroplast) [Diplostephium cinereum]
gb|ARH05741.1| PsbM (chloroplast) [Diplostephium rhomboidale]
gb|ARH05826.1| PsbM (chloroplast) [Diplostephium violaceum]
gb|ARH06251.1| PsbM (chloroplast) [Diplostephium eriophorum]
gb|ARH06336.1| PsbM (chloroplast) [Diplostephium glutinosum]
gb|ARH06421.1| PsbM (chloroplast) [Diplostephium antioquense]
gb|ARH06506.1| PsbM (chloroplast) [Laennecia sophiifolia]
gb|ARH06676.1| PsbM (chloroplast) [Diplostephium costaricense]
gb|ARH07016.1| PsbM (chloroplast) [Diplostephium crypteriophyllum]
gb|ARH07101.1| PsbM (chloroplast) [Diplostephium oblongifolium]
gb|ARH07271.1| PsbM (chloroplast) [Llerasia caucana]
gb|ARH07441.1| PsbM (chloroplast) [Hinterhubera ericoides]
gb|ARH07526.1| PsbM (chloroplast) [Diplostephium romeroi]
gb|ARH07696.1| PsbM (chloroplast) [Diplostephium juajibioyi]
gb|ARH07781.1| PsbM (chloroplast) [Diplostephium venezuelense]
gb|ARH07866.1| PsbM (chloroplast) [Diplostephium huertasii]
gb|ARH08206.1| PsbM (chloroplast) [Diplostephium meyenii]
gb|ARH08291.1| PsbM (chloroplast) [Diplostephium obtusum]
gb|ARH08376.1| PsbM (chloroplast) [Westoniella kohkemperi]
gb|ARH08461.1| PsbM (chloroplast) [Diplostephium tachirense]
gb|ARH08546.1| PsbM (chloroplast) [Parastrephia quadrangularis]
gb|ARH08631.1| PsbM (chloroplast) [Diplostephium serratifolium]
gb|ARH08801.1| PsbM (chloroplast) [Diplostephium schultzii]
gb|ARH08886.1| PsbM (chloroplast) [Diplostephium frontinense]
gb|ARH08971.1| PsbM (chloroplast) [Diplostephium jaramilloi]
gb|ARH09056.1| PsbM (chloroplast) [Diplostephium mutiscuanum]
gb|ARH09141.1| PsbM (chloroplast) [Diplostephium inesianum]
gb|ARH09226.1| PsbM (chloroplast) [Diplostephium heterophyllum]
gb|ARH09396.1| PsbM (chloroplast) [Diplostephium camargoanum]
gb|ARH09481.1| PsbM (chloroplast) [Diplostephium jenesanum]
gb|ARH09565.1| PsbM (chloroplast) [Aztecaster matudae]
gb|ARH09650.1| PsbM (chloroplast) [Diplostephium schultzii]
gb|ARH09735.1| PsbM (chloroplast) [Diplostephium coriaceum]
gb|ARH09905.1| PsbM (chloroplast) [Diplostephium rosmarinifolium]
gb|ARH10245.1| PsbM (chloroplast) [Diplostephium apiculatum]
gb|ARH10415.1| PsbM (chloroplast) [Diplostephium ochraceum]
gb|ARH53474.1| photosystem II protein M (chloroplast) [Schisandra chinensis]
gb|ARI43524.1| photosystem II protein M (chloroplast) [Actinidia arguta]
gb|ARI43608.1| photosystem II protein M (chloroplast) [Actinidia eriantha]
gb|ARI43692.1| photosystem II protein M (chloroplast) [Actinidia kolomikta]
gb|ARI44169.1| photosystem II protein M (chloroplast) [Lepidium meyenii]
gb|ARI49838.1| photosystem II protein M (plastid) [Ipomoea trifida]
gb|ARJ60987.1| photosystem II protein M (plastid) [Illicium floridanum]
gb|ARJ61071.1| photosystem II protein M (plastid) [Dioscorea villosa]
gb|ARJ61154.1| PsbM (plastid) [Magnolia biondii]
gb|ARJ61239.1| photosystem II protein M (plastid) [Digitalis lanata]
gb|ARJ61319.1| photosystem II protein M (plastid) [Illicium verum]
gb|ARJ61495.1| photosystem II protein M (plastid) [Jasminum tortuosum]
gb|ARJ61665.1| photosystem II M protein (plastid) [Scutellaria lateriflora]
gb|ARJ61837.1| photosystem II protein M (plastid) [Jasminum sambac]
gb|ARJ62511.1| photosystem II protein M (plastid) [Illicium henryi]
gb|ARJ63018.1| PsbM (plastid) [Magnolia officinalis]
gb|ARJ63102.1| PsbM (plastid) [Magnolia denudata]
gb|ARJ63186.1| photosystem II protein M (plastid) [Hydrastis canadensis]
gb|ARJ63266.1| photosystem II protein M (plastid) [Illicium anisatum]
gb|ARO91679.1| photosystem II protein M (chloroplast) [Streptogyna americana]
gb|ARQ27654.1| photosystem II protein M (chloroplast) [Humbertochloa
bambusiuscula]
gb|ARQ28240.1| PsbM (chloroplast) [Phyllorachis sagittata]
gb|ARQ28411.1| photosystem II protein M (chloroplast) [Rhipidocladum pittieri]
gb|ARQ81361.1| photosystem II M protein (chloroplast) [Aconitum carmichaelii]
gb|ARR27819.1| photosystem II protein M (chloroplast) [Aster altaicus]
gb|ARS00927.1| PsbM (chloroplast) [Chenopodium quinoa]
gb|ARS01011.1| PsbM (chloroplast) [Chenopodium album]
gb|ARS01095.1| PsbM (chloroplast) [Solanum berthaultii]
gb|ARS43895.1| photosystem II protein M (chloroplast) [Chionanthus retusus]
gb|ARS44173.1| photosystem II protein M (chloroplast) [Morella rubra]
gb|ARS44256.1| photosystem II protein M (chloroplast) [Morella rubra]
gb|ARS44339.1| photosystem II protein M (chloroplast) [Morella rubra]
gb|ARU77235.1| photosystem II protein M (chloroplast) [Ocimum basilicum]
gb|ARV86662.1| photosystem II M protein (chloroplast) [Salvia japonica]
gb|ARV87350.1| photosystem II protein M (chloroplast) [Chenopodium quinoa]
dbj|BAX89000.1| photosystem II protein M (chloroplast) [Dendrobium salaccense]
gb|ARX79234.1| photosystem II protein M (chloroplast) [Camptotheca acuminata]
gb|ARX79316.1| photosystem II protein M (chloroplast) [Decaisnea insignis]
gb|ASA46270.1| photosystem II protein M (chloroplast) [Aldrovanda vesiculosa]
gb|ASA46350.1| photosystem II protein M (chloroplast) [Dionaea muscipula]
gb|ASA46577.1| photosystem II protein M (chloroplast) [Sinojackia xylocarpa]
gb|ASB29525.1| photosystem II protein M (chloroplast) [Barclaya longifolia]
gb|ASB29998.1| photosystem II protein M (chloroplast) [Carpinus cordata]
gb|ASD34247.1| photosystem II protein M (chloroplast) [Castanea mollissima]
gb|ASD34330.1| photosystem II protein M (chloroplast) [Actinidia kolomikta]
gb|ASF62410.1| photosystem II protein M (chloroplast) [Magnolia alba]
gb|ASK06628.1| photosystem II protein M (plastid) [Schima argentea]
gb|ASK06715.1| photosystem II protein M (plastid) [Schima brevipedicellata]
gb|ASK06802.1| photosystem II protein M (plastid) [Schima crenata]
gb|ASK06889.1| photosystem II protein M (plastid) [Schima khasiana]
gb|ASK06976.1| photosystem II protein M (plastid) [Schima multibracteata]
gb|ASK07063.1| photosystem II protein M (plastid) [Schima noronhae]
gb|ASK07150.1| photosystem II protein M (plastid) [Schima remotiserrata]
gb|ASK07237.1| photosystem II protein M (plastid) [Schima sericans]
gb|ASK07324.1| photosystem II protein M (plastid) [Schima sinensis]
gb|ASK07411.1| photosystem II protein M (plastid) [Schima superba]
gb|ASK07498.1| photosystem II protein M (plastid) [Schima wallichii]
gb|ASL06280.1| photosystem II protein M (chloroplast) [Zantedeschia aethiopica]
gb|ASL69858.1| photosystem II protein M (chloroplast) [Musella lasiocarpa]
gb|ASM42132.1| photosystem II protein M (plastid) [Pyrenaria menglaensis]
gb|ASM42152.1| photosystem II protein M (plastid) [Stewartia sinensis]
gb|ASM42306.1| photosystem II protein M (plastid) [Camellia oleifera]
gb|ASM42393.1| photosystem II protein M (plastid) [Apterosperma oblata]
gb|ASM42480.1| photosystem II protein M (plastid) [Pyrenaria pingpienensis]
gb|ASM42567.1| photosystem II protein M (plastid) [Pyrenaria spectabilis var.
greeniae]
gb|ASM42654.1| photosystem II protein M (plastid) [Polyspora speciosa]
gb|ASM42741.1| photosystem II protein M (plastid) [Pyrenaria khasiana]
gb|ASM42828.1| photosystem II protein M (plastid) [Pyrenaria spectabilis var.
greeniae]
gb|ASM42915.1| photosystem II protein M (plastid) [Camellia tachangensis var.
remotiserrata]
gb|ASM43002.1| photosystem II protein M (plastid) [Polyspora axillaris]
gb|ASM43089.1| photosystem II protein M (plastid) [Gordonia brandegeei]
gb|ASM43176.1| photosystem II protein M (plastid) [Pyrenaria microcarpa]
gb|ASM43263.1| photosystem II protein M (plastid) [Tutcheria championii]
gb|ASM43350.1| photosystem II protein M (plastid) [Stewartia crassifolia]
gb|ASM43437.1| photosystem II protein M (plastid) [Camellia mairei]
gb|ASM43524.1| photosystem II protein M (plastid) [Polyspora longicarpa]
gb|ASM43611.1| photosystem II protein M (plastid) [Polyspora dalgleishiana]
gb|ASM43698.1| photosystem II protein M (plastid) [Stewartia pteropetiolata]
gb|ASM43785.1| photosystem II protein M (plastid) [Pyrenaria hirta var. hirta]
gb|ASM43872.1| photosystem II protein M (plastid) [Pyrenaria jonquieriana subsp.
multisepala]
gb|ASM43892.1| photosystem II protein M (plastid) [Stewartia malacodendron]
gb|ASM44046.1| photosystem II protein M (plastid) [Franklinia alatamaha]
gb|ASM44133.1| photosystem II protein M (plastid) [Stewartia cordifolia]
gb|ASM44220.1| photosystem II protein M (plastid) [Polyspora hainanensis]
gb|ASM44307.1| photosystem II protein M (plastid) [Stewartia rubiginosa]
gb|ASM44394.1| photosystem II protein M (plastid) [Camellia szechuanensis]
gb|ASM44481.1| photosystem II protein M (plastid) [Pyrenaria oblongicarpa]
gb|ASM44568.1| photosystem II protein M (plastid) [Stewartia ovata]
gb|ASM44655.1| photosystem II protein M (plastid) [Stewartia calcicola]
gb|ASM44676.1| photosystem II protein M (plastid) [Schima brevipedicellata]
gb|ASM44829.1| photosystem II protein M (plastid) [Pyrenaria hirta var. cordatula]
gb|ASM44916.1| photosystem II protein M (plastid) [Stewartia pseudocamellia]
gb|ASM44936.1| photosystem II protein M (plastid) [Stewartia rostrata]
gb|ASM45090.1| photosystem II protein M (plastid) [Gordonia lasianthus]
gb|ASM45177.1| photosystem II protein M (plastid) [Camellia elongata]
gb|ASM45264.1| photosystem II protein M (plastid) [Gordonia fruticosa]
gb|ASM45351.1| photosystem II protein M (plastid) [Camellia reticulata]
gb|ASM45438.1| photosystem II protein M (plastid) [Barringtonia fusicarpa]
gb|ASM45525.1| photosystem II protein M (plastid) [Symplocos paniculata]
gb|ASM45612.1| photosystem II protein M (plastid) [Diospyros dumetorum]
gb|ASM45699.1| photosystem II protein M (plastid) [Pyrenaria diospyricarpa]
gb|ASM45786.1| photosystem II protein M (plastid) [Barringtonia racemosa]
gb|ASM45873.1| photosystem II protein M (plastid) [Ternstroemia gymnanthera]
gb|ASM45960.1| photosystem II protein M (plastid) [Adinandra angustifolia]
gb|ASM46047.1| photosystem II protein M (plastid) [Adinandra millettii]
gb|ASM46221.1| photosystem II protein M (plastid) [Sladenia celastrifolia]
gb|ASM46308.1| photosystem II protein M (plastid) [Diospyros strigosa]
gb|ASM46395.1| photosystem II protein M (plastid) [Symplocos costaricana]
gb|ASM46482.1| photosystem II protein M (plastid) [Anneslea fragrans]
gb|ASM46656.1| photosystem II protein M (plastid) [Sinojackia rehderiana]
gb|ASM46741.1| photosystem II protein M (plastid) [Melliodendron xylocarpum]
gb|ASO75404.1| photosystem II protein M (chloroplast) [Camellia azalea]
gb|ASO76255.1| photosystem II protein M (chloroplast) [Musa itinerans]
gb|ASO76670.1| photosystem II protein M (chloroplast) [Solanum dulcamara]
gb|ASQ40473.1| photosystem II protein M (chloroplast) [Caryopteris mongholica]
gb|ASR92413.1| photosystem II protein M (chloroplast) [Solanum lycopersicum]
gb|ASR92500.1| photosystem II protein M (chloroplast) [Solanum lycopersicum]
gb|ASR92587.1| photosystem II protein M (chloroplast) [Solanum pennellii]
gb|ASS35088.1| photosystem II protein M (chloroplast) [Magnolia insignis]
gb|ASU93086.1| PSII low MW protein M (chloroplast) [Pelatantheria
scolopendrifolia]
gb|ASU93160.1| PSII low MW protein M (chloroplast) [Gastrochilus fuscopunctatus]
gb|ASU93234.1| PSII low MW protein M (chloroplast) [Thrixspermum japonicum]
gb|ASU93381.1| PSII low MW protein M (chloroplast) [Gastrochilus japonicus]
gb|ASV47853.1| photosystem II protein M (chloroplast) [Ambrosia artemisiifolia]
gb|ASV47959.1| PSII M protein (chloroplast) [Echinacanthus lofouensis]
gb|ASW20433.1| photosystem II protein M (chloroplast) [Alpinia oxyphylla]
gb|ASW20516.1| photosystem II protein M (chloroplast) [Conyza bonariensis]
gb|ASW26394.1| photosystem II protein M (plastid) [Rheum wittrockii]
gb|ASW34572.1| photosystem II protein M (chloroplast) [Nicotiana attenuata]
gb|ASX99423.1| photosystem II protein M (chloroplast) [Magnolia laevifolia]
gb|ATD53175.1| photosystem II protein M (chloroplast) [Pedicularis
cheilanthifolia]
gb|ATG24472.1| photosystem II protein M (chloroplast) [Sinowilsonia henryi]
gb|ATG27948.1| photosystem II protein M (chloroplast) [Primulina brachytricha var.
magnibracteata]
gb|ATG28036.1| photosystem II protein M (chloroplast) [Primulina eburnea]
gb|ATG28124.1| photosystem II protein M (chloroplast) [Primulina liboensis]
gb|ATG83077.1| photosystem II protein M (chloroplast) [Colocasia esculenta]
gb|ATI10625.1| photosystem II protein M (chloroplast) [Aristolochia contorta]
gb|ATI10710.1| photosystem II protein M (chloroplast) [Aristolochia debilis]
emb|CUS18791.1| photosystem II protein M (plastid) [Japonolirion osense]
gb|ATI96654.1| photosystem II protein M (chloroplast) [Przewalskia tangutica]
gb|ATJ03104.1| photosystem II protein M (chloroplast) [Liparis loeselii]
gb|ATJ03197.1| photosystem II protein M (chloroplast) [Cardamine macrophylla]
gb|ATL16514.1| photosystem II protein M (chloroplast) [Atractylodes macrocephala]
gb|ATL16755.1| photosystem II protein M (chloroplast) [Cirsium japonicum var.
maackii]
gb|ATL16820.1| photosystem II protein M (chloroplast) [Cirsium japonicum var.
spinosissimum]
gb|ATL22964.1| PsbM (chloroplast) [Solanum chacoense]
gb|ATL23051.1| PsbM (chloroplast) [Solanum hougasii]
gb|ATL23138.1| PsbM (chloroplast) [Solanum stoloniferum]
gb|ATN40559.1| photosystem II protein M (chloroplast) [Camptotheca acuminata]
gb|ATN40576.1| photosystem II protein M (chloroplast) [Portulaca oleracea]
gb|PHT53269.1| Photosystem II reaction center protein M [Capsicum baccatum]
gb|PHT61372.1| Photosystem II reaction center protein M [Capsicum annuum]
gb|PHT62427.1| Photosystem II reaction center protein M [Capsicum annuum]
gb|PHT69983.1| Photosystem II reaction center protein M [Capsicum annuum]
gb|PHT70436.1| Photosystem II reaction center protein M [Capsicum annuum]
gb|PHT74389.1| Photosystem II reaction center protein M [Capsicum annuum]
gb|PHT94087.1| Photosystem II reaction center protein M [Capsicum annuum]
gb|PHT96867.1| Photosystem II reaction center protein M [Capsicum chinense]
gb|PHU29406.1| Photosystem II reaction center protein M [Capsicum chinense]
gb|ATP74784.1| photosystem II protein M (chloroplast) [Pleione bulbocodioides]
gb|ATQ37743.1| photosystem II protein M (chloroplast) [Littledalea racemosa]
gb|ATU06802.1| photosystem II M protein (chloroplast) [Aconitum angustius]
gb|ATU06884.1| photosystem II M protein (chloroplast) [Aconitum finetianum]
gb|ATU06966.1| photosystem II M protein (chloroplast) [Aconitum sinomontanum]
gb|ATU07161.1| photosystem II protein M (chloroplast) [Forsythia suspensa]
gb|ATU31917.1| photosystem II protein M (chloroplast) [Quercus tarokoensis]
gb|ATV81541.1| PsbM (chloroplast) [Oryza eichingeri]
gb|ATV81640.1| PsbM (chloroplast) [Oryza latifolia]
gb|ATV81739.1| PsbM (chloroplast) [Oryza rhizomatis]
gb|ATV81838.1| PsbM (chloroplast) [Oryza meyeriana]
gb|ATV96654.1| photosystem II protein M (chloroplast) [Couroupita guianensis]
gb|ATV96745.1| photosystem II protein M (chloroplast) [Couratari stellata]
gb|ATV96836.1| photosystem II protein M (chloroplast) [Eschweilera congestiflora]
gb|ATV97283.1| photosystem II protein M (chloroplast) [Eschweilera integrifolia]
gb|ATV97374.1| photosystem II protein M (chloroplast) [Gustavia augusta]
gb|ATV97465.1| photosystem II protein M (chloroplast) [Couratari macrosperma]
gb|ATV97647.1| photosystem II protein M (chloroplast) [Corythophora labriculata]
gb|ATV97829.1| photosystem II protein M (chloroplast) [Bertholletia excelsa]
gb|ATV98011.1| photosystem II protein M (chloroplast) [Lecythis corrugata]
gb|ATV98102.1| photosystem II protein M (chloroplast) [Lecythis ampla]
gb|ATV98192.1| photosystem II protein M (chloroplast) [Grias cauliflora]
gb|ATV98283.1| photosystem II protein M (chloroplast) [Lecythis pneumatophora]
gb|ATV98462.1| photosystem II protein M (chloroplast) [Corythophora amapaensis]
gb|ATV98552.1| photosystem II protein M (chloroplast) [Barringtonia edulis]
gb|ATV98639.1| photosystem II protein M (chloroplast) [Eschweilera caudiculata]
gb|ATV95886.1| photosystem II protein M (chloroplast) [Primulina eburnea]
gb|ATV95973.1| photosystem II protein M (chloroplast) [Primulina huaijiensis]
gb|ATV96060.1| photosystem II protein M (chloroplast) [Primulina linearifolia]
gb|ATX68341.1| photosystem II protein M (chloroplast) [Colobanthus apetalus]
gb|ATY40682.1| photosystem II protein M (chloroplast) [Symplocos ovatilobata]
gb|ATY40838.1| photosystem II protein M (chloroplast) [Saussurea polylepis]
gb|ATY47872.1| photosystem II protein M (chloroplast) [Adenocalymma
allamandiflorum]
gb|ATY47957.1| photosystem II protein M (chloroplast) [Adenocalymma aurantiacum]
gb|ATY48041.1| photosystem II protein M (chloroplast) [Adenocalymma biternatum]
gb|ATY48126.1| photosystem II protein M (chloroplast) [Adenocalymma bracteatum]
gb|ATY48211.1| photosystem II protein M (chloroplast) [Adenocalymma cristicalyx]
gb|ATY48296.1| photosystem II protein M (chloroplast) [Adenocalymma hatschbachii]
gb|ATY48381.1| photosystem II protein M (chloroplast) [Adenocalymma pedunculatum]
gb|ATY48465.1| photosystem II protein M (chloroplast) [Adenocalymma peregrinum]
gb|ATY48549.1| photosystem II protein M (chloroplast) [Adenocalymma subspicatum]
gb|ATY48634.1| photosystem II protein M (chloroplast) [Neojobertia candolleana]
gb|ATY69639.1| photosystem II protein M (chloroplast) [Achyrachaena mollis]
gb|AUB29865.1| photosystem II M protein (chloroplast) [Aconitum reclinatum]
gb|AUB30061.1| photosystem II protein M (chloroplast) [Actinidia arguta]
gb|AUD57892.1| photosystem II protein M (chloroplast) [Landoltia punctata]
gb|AUF33264.1| PsbM (chloroplast) [Diplopanax stachyanthus]
gb|AUF33604.1| PsbM (chloroplast) [Nyssa wenshanensis]
gb|AUF33689.1| PsbM (chloroplast) [Alangium chinense]
gb|AUF33774.1| PsbM (chloroplast) [Fouquieria diguetii]
gb|AUF33944.1| PsbM (chloroplast) [Curtisia dentata]
gb|AUF34029.1| PsbM (chloroplast) [Nyssa sinensis]
gb|AUF34114.1| PsbM (chloroplast) [Mastixia caudatilimba]
gb|AUF34199.1| PsbM (chloroplast) [Davidia involucrata]
gb|AUF34284.1| PsbM (chloroplast) [Alangium alpinum]
gb|AUF34369.1| PsbM (chloroplast) [Cornus controversa]
gb|AUF34454.1| PsbM (chloroplast) [Camptotheca acuminata]
gb|AUG33540.1| photosystem II protein M (chloroplast) [Chenopodium quinoa]
gb|AUG60969.1| photosystem II protein M (chloroplast) [Alnus alnobetula subsp.
crispa]
gb|AUG61054.1| photosystem II protein M (chloroplast) [Alnus alnobetula subsp.
suaveolens]
gb|AUG61139.1| photosystem II protein M (chloroplast) [Alnus cordata]
gb|AUG61224.1| photosystem II protein M (chloroplast) [Alnus alnobetula subsp.
alnobetula]
gb|AUG61309.1| photosystem II protein M (chloroplast) [Alnus glutinosa subsp.
betuloides]
gb|AUG61394.1| photosystem II protein M (chloroplast) [Alnus cordata]
gb|AUG61479.1| photosystem II protein M (chloroplast) [Alnus glutinosa subsp.
barbata]
gb|AUG61564.1| photosystem II protein M (chloroplast) [Alnus glutinosa subsp.
glutinosa]
gb|AUG61714.1| photosystem II protein M (chloroplast) [Alnus glutinosa subsp.
glutinosa]
gb|AUG61734.1| photosystem II protein M (chloroplast) [Alnus glutinosa subsp.
glutinosa]
gb|AUG61819.1| photosystem II protein M (chloroplast) [Alnus incana]
gb|AUG62054.1| photosystem II protein M (chloroplast) [Alnus japonica]
gb|AUG61904.1| photosystem II protein M (chloroplast) [Alnus incana]
gb|AUG62074.1| photosystem II protein M (chloroplast) [Alnus jorullensis subsp.
jorullensis]
gb|AUG62159.1| photosystem II protein M (chloroplast) [Alnus maritima subsp.
maritima]
gb|AUG62244.1| photosystem II protein M (chloroplast) [Alnus maritima subsp.
maritima]
gb|AUG62329.1| photosystem II protein M (chloroplast) [Alnus maritima subsp.
oklahomensis]
gb|AUG62414.1| photosystem II protein M (chloroplast) [Alnus maximowiczii]
gb|AUG62499.1| photosystem II protein M (chloroplast) [Alnus nitida]
gb|AUG62649.1| photosystem II protein M (chloroplast) [Alnus orientalis]
gb|AUG62669.1| photosystem II protein M (chloroplast) [Alnus rubra]
gb|AUG62754.1| photosystem II protein M (chloroplast) [Alnus subcordata]
gb|AUJ21985.1| photosystem II protein M (chloroplast) [Oryza coarctata]
gb|AUJ22482.1| photosystem II protein M (chloroplast) [Solanum melongena]
gb|AUJ22644.1| photosystem II protein M (chloroplast) [Ambrosia artemisiifolia]
gb|AUJ22730.1| photosystem II protein M (chloroplast) [Ambrosia trifida]
gb|AUJ22814.1| photosystem II protein M (chloroplast) [Nicotiana attenuata]
gb|AUL75806.1| photosystem II protein M (plastid) [Oldeania alpina]
gb|AUL75889.1| photosystem II protein M (plastid) [Chimonobambusa tumidissinoda]
gb|AUL75970.1| photosystem II protein M (plastid) [Ampelocalamus actinotrichus]
gb|AUL76052.1| photosystem II protein M (plastid) [Bergbambos tessellata]
gb|AUL76135.1| photosystem II protein M (plastid) [Oldeania humbertii]
gb|AUL76218.1| photosystem II protein M (plastid) [Oldeania humbertii]
gb|AUL76300.1| photosystem II protein M (plastid) [Oldeania ibityensis]
gb|AUL76384.1| photosystem II protein M (plastid) [Indocalamus sinicus]
gb|AUL76466.1| photosystem II protein M (plastid) [Indosasa shibataeoides]
gb|AUL76549.1| photosystem II protein M (plastid) [Oldeania itremoensis]
gb|AUL76627.1| photosystem II protein M (plastid) [Kuruna debilis]
gb|AUL76714.1| photosystem II protein M (plastid) [Oldeania cf. madagascariensis
PFM-2018]
gb|AUL76796.1| photosystem II protein M (plastid) [Pseudosasa cantorii]
gb|AUL76879.1| photosystem II protein M (plastid) [Sasa longiligulata]
gb|AUL76962.1| photosystem II protein M (plastid) [Shibataea chiangshanensis]
gb|AUN28376.1| photosystem II protein M (chloroplast) [Genlisea filiformis]
gb|AUN28451.1| photosystem II protein M (chloroplast) [Genlisea pygmaea]
gb|AUN28526.1| photosystem II protein M (chloroplast) [Genlisea repens]
gb|AUN28678.1| photosystem II protein M (chloroplast) [Genlisea violacea]
gb|AUO29254.1| photosystem II protein M (chloroplast) [Camellia japonica]
gb|AUS83989.1| photosystem II protein M (chloroplast) [Amomum krervanh]
gb|AUS84088.1| photosystem II protein M (chloroplast) [Acrocomia aculeata]
gb|AUS84241.1| photosystem II protein M (chloroplast) [Quercus tungmaiensis]
gb|AUS84843.1| photosystem II protein M (plastid) [Quercus sichourensis]
gb|AUT81601.1| photosystem II protein M (plastid) [Cardamine amara]
gb|AUT81687.1| photosystem II reaction center protein M (plastid) [Cardamine
oligosperma]
gb|AUT81773.1| photosystem II reaction center protein M (plastid) [Cardamine
parviflora]
gb|AUT82126.1| PSII M protein (plastid) [Galeopsis tetrahit]
gb|AUT82382.1| PSII M protein (plastid) [Lamium album]
gb|AUT82472.1| PSII M protein (plastid) [Lamium galeobdolon]
gb|AUT82818.1| photosystem II protein M (plastid) [Ranunculus repens]
gb|AUT82903.1| photosystem II reaction center protein M (plastid) [Ranunculus
flammula]
gb|AUT82988.1| photosystem II protein M (plastid) [Ranunculus reptans]
gb|AUT83070.1| photosystem II protein M (plastid) [Silene uniflora]
gb|AUT83361.1| photosystem II protein M (plastid) [Carex acutiformis]
gb|AUT83419.1| photosystem II protein M (plastid) [Carex flacca]
gb|AUT83457.1| photosystem II protein M (plastid) [Carex pallescens]
gb|AUT83870.1| photosystem II protein M (chloroplast) [Chionanthus parkinsonii]
gb|AUT83958.1| photosystem II protein M (chloroplast) [Chionanthus rupicola]
gb|AUT84046.1| photosystem II protein M (chloroplast) [Fontanesia phillyreoides
subsp. fortunei]
gb|AUT84133.1| photosystem II protein M (chloroplast) [Forestiera isabelae]
gb|AUT84221.1| photosystem II protein M (chloroplast) [Forsythia x intermedia]
gb|AUT84307.1| photosystem II protein M (chloroplast) [Fraxinus ornus]
gb|AUT84395.1| photosystem II protein M (chloroplast) [Nestegis apetala]
gb|AUT84483.1| photosystem II protein M (chloroplast) [Noronhia lowryi]
gb|AUT84571.1| photosystem II protein M (chloroplast) [Olea europaea subsp.
cuspidata]
gb|AUT84658.1| photosystem II protein M (chloroplast) [Olea europaea subsp.
europaea]
gb|AUT84747.1| photosystem II protein M (chloroplast) [Olea europaea subsp.
europaea]
gb|AUT84835.1| photosystem II protein M (chloroplast) [Olea europaea subsp.
europaea]
gb|AUT84923.1| photosystem II protein M (chloroplast) [Olea europaea subsp.
guanchica]
gb|AUT85011.1| photosystem II protein M (chloroplast) [Olea europaea subsp.
laperrinei]
gb|AUT85098.1| photosystem II protein M (chloroplast) [Olea exasperata]
gb|AUT85186.1| photosystem II protein M (chloroplast) [Schrebera arborea]
gb|AUT85274.1| photosystem II protein M (chloroplast) [Syringa vulgaris]
gb|AUW35021.1| photosystem II protein M (chloroplast) [Amomum compactum]
gb|AUW35403.1| photosystem II protein M (chloroplast) [Magnolia aromatica]
gb|AUW35489.1| photosystem II protein M (chloroplast) [Magnolia fordiana var.
calcarea]
gb|AUW35575.1| photosystem II protein M (chloroplast) [Magnolia conifera]
gb|AUW35661.1| photosystem II protein M (chloroplast) [Magnolia duclouxii]
gb|AUW35747.1| photosystem II protein M (chloroplast) [Magnolia glaucifolia]
gb|AUW35833.1| photosystem II protein M (chloroplast) [Magnolia insignis]
gb|AUW35919.1| photosystem II protein M (chloroplast) [Magnolia dandyi]
gb|AUW36005.1| photosystem II protein M (chloroplast) [Magnolia alba]
gb|AVA07782.1| photosystem II protein M (chloroplast) [Prosphytochloa prehensilis]
gb|AVA08534.1| photosystem II protein M (chloroplast) [Drepanostachyum falcatum]
gb|AVA08929.1| photosystem II protein M (chloroplast) [Scutellaria baicalensis]
gb|AVA09016.1| photosystem II protein M (chloroplast) [Scutellaria baicalensis]
gb|AVA09390.1| photosystem II protein M (plastid) [Fraxinus chiisanensis]
gb|AVC55536.1| PsbM (chloroplast) [Streptocarpus teitensis]
gb|AVD53924.1| PsbM (chloroplast) [Asarum sieboldii]
gb|AVD96766.1| photosystem II protein M (chloroplast) [Anemoclema glaucifolium]
gb|AVE14934.1| PSII M protein (chloroplast) [Forsythia saxatilis]
gb|AVF97078.1| photosystem II protein M (chloroplast) [Anemopaegma acutifolium]
gb|AVF97176.1| photosystem II protein M (chloroplast) [Anemopaegma acutifolium]
gb|AVF97274.1| photosystem II protein M (chloroplast) [Anemopaegma album]
gb|AVF97372.1| photosystem II protein M (chloroplast) [Anemopaegma arvense]
gb|AVF97470.1| photosystem II protein M (chloroplast) [Anemopaegma arvense]
gb|AVF97568.1| photosystem II protein M (chloroplast) [Anemopaegma chamberlaynii]
gb|AVF97666.1| photosystem II protein M (chloroplast) [Anemopaegma foetidum]
gb|AVF97764.1| photosystem II protein M (chloroplast) [Anemopaegma glaucum]
gb|AVF97862.1| photosystem II protein M (chloroplast) [Anemopaegma glaucum]
gb|AVF97960.1| photosystem II protein M (chloroplast) [Anemopaegma oligoneuron]
gb|AVI15290.1| photosystem II protein M (chloroplast) [Parrotia subaequalis]
gb|AVI15377.1| photosystem II protein M (chloroplast) [Parrotia subaequalis]
gb|AVI15647.1| PsbM (chloroplast) [Oryza sativa]
gb|AVI16381.1| photosystem II M protein (chloroplast) [Mentha spicata]
gb|AVI16554.1| photosystem II protein M (chloroplast) [Camellia oleifera]
gb|AVI26173.1| photosystem II protein M (chloroplast) [Castanopsis hainanensis]
gb|AVK42911.1| photosystem II protein M (chloroplast) [Conyza bonariensis]
gb|AVK80167.1| photosystem II protein M (chloroplast) [Pedicularis hallaisanensis]
gb|AVM10641.1| photosystem II protein M (chloroplast) [Epipactis mairei]
gb|AVM38732.1| photosystem II protein M (chloroplast) [Fraxinus excelsior]
gb|AVM81558.1| photosystem II protein M (chloroplast) [Adenocalymma marginatum]
gb|AVM81641.1| photosystem II protein M (chloroplast) [Adenocalymma nodosum]
gb|AVM81726.1| photosystem II protein M (chloroplast) [Adenocalymma trifoliatum]
gb|AVM81811.1| photosystem II protein M (chloroplast) [Dolichandra cynanchoides]
gb|AVM81896.1| photosystem II protein M (chloroplast) [Pleonotoma albiflora]
gb|AVM81981.1| photosystem II protein M (chloroplast) [Tecomaria capensis]
gb|AVM82069.1| photosystem II protein M (chloroplast) [Adenocalymma acutissimum]
gb|AVM82149.1| photosystem II protein M (chloroplast) [Adenocalymma cymbalum]
gb|AVM82235.1| photosystem II protein M (chloroplast) [Adenocalymma juliae]
gb|AVM82320.1| photosystem II protein M (chloroplast) [Adenocalymma macrophyllum]
gb|AVM82407.1| photosystem II protein M (chloroplast) [Adenocalymma scabriusculum]
gb|AVM82493.1| photosystem II protein M (chloroplast) [Adenocalymma
subsessilifolium]
gb|AVM82592.1| photosystem II protein M (chloroplast) [Anemopaegma arvense]
gb|AVM82674.1| photosystem II protein M (chloroplast) [Cuspidaria floribunda]
gb|AVM82759.1| photosystem II protein M (chloroplast) [Podranea ricasoliana]
gb|AVM82856.1| photosystem II protein M (chloroplast) [Pyrostegia venusta]
gb|AVM82938.1| photosystem II protein M (chloroplast) [Adenocalymma ackermannii]
gb|AVM83018.1| photosystem II protein M (chloroplast) [Adenocalymma adenophorum]
gb|AVM83094.1| photosystem II protein M (chloroplast) [Adenocalymma apurense]
gb|AVM83171.1| photosystem II protein M (chloroplast) [Adenocalymma calcareum]
gb|AVM83257.1| photosystem II protein M (chloroplast) [Adenocalymma cinereum]
gb|AVM83341.1| photosystem II protein M (chloroplast) [Adenocalymma cladotrichum]
gb|AVM83428.1| photosystem II protein M (chloroplast) [Adenocalymma coriaceum]
gb|AVM83510.1| photosystem II protein M (chloroplast) [Adenocalymma dichilum]
gb|AVM83595.1| photosystem II protein M (chloroplast) [Adenocalymma dusenii]
gb|AVM83672.1| photosystem II protein M (chloroplast) [Adenocalymma flaviflorum]
gb|AVM83752.1| photosystem II protein M (chloroplast) [Adenocalymma gibbosum]
gb|AVM83840.1| photosystem II protein M (chloroplast) [Adenocalymma gracielzae]
gb|AVM83920.1| photosystem II protein M (chloroplast) [Adenocalymma grandifolium]
gb|AVM84006.1| photosystem II protein M (chloroplast) [Adenocalymma hatschbachii]
gb|AVM84085.1| photosystem II protein M (chloroplast) [Adenocalymma hypostictum]
gb|AVM84163.1| photosystem II protein M (chloroplast) [Adenocalymma paulistarum]
gb|AVM84246.1| photosystem II protein M (chloroplast) [Adenocalymma pubescens]
gb|AVM84325.1| photosystem II protein M (chloroplast) [Adenocalymma schomburgkii]
gb|AVM84386.1| photosystem II protein M (chloroplast) [Adenocalymma subincanum]
gb|AVM84454.1| photosystem II protein M (chloroplast) [Adenocalymma ubatubense]
gb|AVM84539.1| photosystem II protein M (chloroplast) [Adenocalymma validum]
gb|AVM84620.1| photosystem II protein M (chloroplast) [Fridericia platyphylla]
gb|AVM84705.1| photosystem II protein M (chloroplast) [Sampaiella trichoclada]
gb|AVN88364.1| photosystem II protein M (chloroplast) [Asarum canadense]
gb|AVN89976.1| photosystem II protein M (chloroplast) [Camellia chekiangoleosa]
gb|AVN90057.1| photosystem II protein M (chloroplast) [Helianthus tuberosus]
gb|AVN97916.1| photosystem II protein M (chloroplast) [Alnus rubra]
gb|AVN98010.1| photosystem II protein M (chloroplast) [Betula cordifolia]
prf||1603356M photosystem II low MW protein [Oryza sativa]
Length = 34
Score = 66.6 bits (161), Expect = 2e-12
Identities = 34/34 (100%), Positives = 34/34 (100%)
Frame = +2
Query: 101 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 202
MEVNILAFIATALFILVPTAFLLIIYVKTVSQND
Sbjct: 1 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 34
>ref|YP_009407099.1| photosystem II protein M (chloroplast) [Platycarya strobilacea]
gb|ASA45980.1| photosystem II protein M (chloroplast) [Platycarya strobilacea]
Length = 37
Score = 66.6 bits (161), Expect = 2e-12
Identities = 34/34 (100%), Positives = 34/34 (100%)
Frame = +2
Query: 101 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 202
MEVNILAFIATALFILVPTAFLLIIYVKTVSQND
Sbjct: 1 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 34
>gb|ATV97192.1| photosystem II protein M (chloroplast) [Allantoma lineata]
gb|ATV97920.1| photosystem II protein M (chloroplast) [Allantoma decandra]
Length = 38
Score = 66.6 bits (161), Expect = 2e-12
Identities = 34/34 (100%), Positives = 34/34 (100%)
Frame = +2
Query: 101 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 202
MEVNILAFIATALFILVPTAFLLIIYVKTVSQND
Sbjct: 1 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 34
>ref|YP_009375686.1| PsbM (chloroplast) [Diplostephium phylicoides]
ref|YP_009376111.1| PsbM (chloroplast) [Diplostephium lacunosum]
gb|ARH06166.1| PsbM (chloroplast) [Diplostephium phylicoides]
gb|ARH06591.1| PsbM (chloroplast) [Diplostephium lacunosum]
Length = 34
Score = 66.2 bits (160), Expect = 2e-12
Identities = 33/34 (97%), Positives = 34/34 (100%)
Frame = +2
Query: 101 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 202
MEVNILAF+ATALFILVPTAFLLIIYVKTVSQND
Sbjct: 1 MEVNILAFVATALFILVPTAFLLIIYVKTVSQND 34
>gb|AKZ30297.1| photosystem II protein M (chloroplast) [Goodenia ovata]
Length = 34
Score = 66.2 bits (160), Expect = 2e-12
Identities = 33/34 (97%), Positives = 34/34 (100%)
Frame = +2
Query: 101 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 202
MEVNILAFIATALF+LVPTAFLLIIYVKTVSQND
Sbjct: 1 MEVNILAFIATALFVLVPTAFLLIIYVKTVSQND 34