BLASTX nr result
ID: Rehmannia32_contig00019377
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00019377 (598 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNT62294.1| hypothetical protein BRADI_4g01207v3 [Brachypodiu... 54 1e-06 >gb|PNT62294.1| hypothetical protein BRADI_4g01207v3 [Brachypodium distachyon] Length = 76 Score = 54.3 bits (129), Expect = 1e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -2 Query: 234 YDMLFFPFIPFQDQSRSSKLYQWYGRIPHFIQICKR 127 YDMLFFPFI +DQS SS+LYQ GRI FIQ+CKR Sbjct: 40 YDMLFFPFITLEDQSWSSRLYQESGRICCFIQMCKR 75