BLASTX nr result
ID: Rehmannia32_contig00019355
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00019355 (644 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZV58502.1| hypothetical protein F511_23755 [Dorcoceras hygro... 34 1e-06 >gb|KZV58502.1| hypothetical protein F511_23755 [Dorcoceras hygrometricum] Length = 184 Score = 34.3 bits (77), Expect(3) = 1e-06 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = -1 Query: 644 LPYLEEHNREPIVIILQMCRAMVFKGKINYS 552 + +LE+ P +IILQMCR+ F+G+I S Sbjct: 76 MSHLEKSGNNPAIIILQMCRSKQFRGEIRVS 106 Score = 33.1 bits (74), Expect(3) = 1e-06 Identities = 13/28 (46%), Positives = 22/28 (78%) Frame = -3 Query: 468 EVKVSNSFHITKLIVNGEEDEIKEFKKR 385 E++VSN+F++TK+IV EI +F++R Sbjct: 102 EIRVSNTFYVTKMIVKESFGEIMQFRER 129 Score = 32.3 bits (72), Expect(3) = 1e-06 Identities = 14/40 (35%), Positives = 28/40 (70%) Frame = -1 Query: 278 SCSISHVVAPSNVTVSDDLTSSESSIRTIEQLYINRQVNT 159 S S+S++ AP+ T+ +D+++++ RTIEQ+ N +V + Sbjct: 137 SNSLSNISAPTPHTIIEDISTAKDLFRTIEQISENNEVGS 176