BLASTX nr result
ID: Rehmannia32_contig00019335
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00019335 (387 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN07832.1| hypothetical protein CDL12_19601 [Handroanthus im... 60 8e-08 >gb|PIN07832.1| hypothetical protein CDL12_19601 [Handroanthus impetiginosus] Length = 329 Score = 59.7 bits (143), Expect = 8e-08 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +3 Query: 195 HSFPLPSFPHVKKAVWGQGHVLVQVNCVSDRSKQT 299 H F +PS PHVKK WGQ HVLVQVNCVS+RS+Q+ Sbjct: 33 HCFSVPSLPHVKKGAWGQRHVLVQVNCVSERSEQS 67