BLASTX nr result
ID: Rehmannia32_contig00019301
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00019301 (485 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN08432.1| hypothetical protein CDL12_18992 [Handroanthus im... 65 7e-10 ref|XP_011091781.1| structure-specific endonuclease subunit SLX1... 61 2e-08 ref|XP_020552812.1| structure-specific endonuclease subunit slx1... 61 4e-08 ref|XP_012830643.1| PREDICTED: structure-specific endonuclease s... 58 2e-07 ref|XP_022896596.1| structure-specific endonuclease subunit SLX1... 57 7e-07 ref|XP_015952991.1| structure-specific endonuclease subunit slx1... 54 9e-06 >gb|PIN08432.1| hypothetical protein CDL12_18992 [Handroanthus impetiginosus] Length = 181 Score = 64.7 bits (156), Expect = 7e-10 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 483 QLFLLQHRYAALNQVKDLIDCSRLEINWHLDPM 385 QL LLQHRYAALNQV D+IDCS LEINWH+DPM Sbjct: 149 QLLLLQHRYAALNQVMDVIDCSHLEINWHIDPM 181 >ref|XP_011091781.1| structure-specific endonuclease subunit SLX1 isoform X2 [Sesamum indicum] Length = 187 Score = 60.8 bits (146), Expect = 2e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 483 QLFLLQHRYAALNQVKDLIDCSRLEINWHLDPM 385 Q+ LLQHRYA+LNQVKD+IDCS LEI+W LDPM Sbjct: 155 QILLLQHRYASLNQVKDVIDCSHLEIDWRLDPM 187 >ref|XP_020552812.1| structure-specific endonuclease subunit slx1 isoform X1 [Sesamum indicum] Length = 225 Score = 60.8 bits (146), Expect = 4e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 483 QLFLLQHRYAALNQVKDLIDCSRLEINWHLDPM 385 Q+ LLQHRYA+LNQVKD+IDCS LEI+W LDPM Sbjct: 155 QILLLQHRYASLNQVKDVIDCSHLEIDWRLDPM 187 >ref|XP_012830643.1| PREDICTED: structure-specific endonuclease subunit SLX1 [Erythranthe guttata] gb|EYU42980.1| hypothetical protein MIMGU_mgv1a014500mg [Erythranthe guttata] Length = 187 Score = 58.2 bits (139), Expect = 2e-07 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -3 Query: 483 QLFLLQHRYAALNQVKDLIDCSRLEINWHLDP 388 QL LLQHRYAALN+VKDL+DC LEI W LDP Sbjct: 155 QLLLLQHRYAALNKVKDLVDCGHLEIEWRLDP 186 >ref|XP_022896596.1| structure-specific endonuclease subunit SLX1 homolog [Olea europaea var. sylvestris] Length = 203 Score = 57.0 bits (136), Expect = 7e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 480 LFLLQHRYAALNQVKDLIDCSRLEINWHLDPM 385 + LLQHR+AALN+VKDLIDCS LEINWHL+ M Sbjct: 172 MLLLQHRHAALNRVKDLIDCSHLEINWHLNLM 203 >ref|XP_015952991.1| structure-specific endonuclease subunit slx1 [Arachis duranensis] Length = 168 Score = 53.5 bits (127), Expect = 9e-06 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -3 Query: 474 LLQHRYAALNQVKDLIDCSRLEINWHLDP 388 LLQHR AALN+VK +DCS LEINWHLDP Sbjct: 139 LLQHRQAALNRVKSSLDCSHLEINWHLDP 167