BLASTX nr result
ID: Rehmannia32_contig00019216
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00019216 (567 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011082963.1| probable sugar phosphate/phosphate transloca... 60 4e-07 ref|XP_012844322.1| PREDICTED: probable sugar phosphate/phosphat... 56 9e-06 >ref|XP_011082963.1| probable sugar phosphate/phosphate translocator At1g06470 [Sesamum indicum] ref|XP_011082964.1| probable sugar phosphate/phosphate translocator At1g06470 [Sesamum indicum] ref|XP_020550475.1| probable sugar phosphate/phosphate translocator At1g06470 [Sesamum indicum] Length = 500 Score = 59.7 bits (143), Expect = 4e-07 Identities = 32/58 (55%), Positives = 34/58 (58%) Frame = -3 Query: 175 ITNKDKRQGIRREPSFSGWCDEDGIPRPARLTXXXXXXXXXXXELPLVQPQRPENKVL 2 +T +DK I REPSFSGW DEDGIP PARL L LVQPQ EN VL Sbjct: 20 LTREDKSVRISREPSFSGWFDEDGIPLPARLRNDEVNEEDFVFRLHLVQPQGSENGVL 77 >ref|XP_012844322.1| PREDICTED: probable sugar phosphate/phosphate translocator At1g06470 [Erythranthe guttata] ref|XP_012844323.1| PREDICTED: probable sugar phosphate/phosphate translocator At1g06470 [Erythranthe guttata] ref|XP_012844324.1| PREDICTED: probable sugar phosphate/phosphate translocator At1g06470 [Erythranthe guttata] gb|EYU31629.1| hypothetical protein MIMGU_mgv1a005699mg [Erythranthe guttata] Length = 474 Score = 55.8 bits (133), Expect = 9e-06 Identities = 29/56 (51%), Positives = 33/56 (58%) Frame = -3 Query: 169 NKDKRQGIRREPSFSGWCDEDGIPRPARLTXXXXXXXXXXXELPLVQPQRPENKVL 2 +K KR GIRREPSFSGW DEDGIP P++L LPL Q + EN L Sbjct: 15 SKVKRIGIRREPSFSGWYDEDGIPYPSQLINDEVNVEEFDFNLPLAQTRSSENDSL 70