BLASTX nr result
ID: Rehmannia32_contig00019201
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00019201 (375 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32418.1| hypothetical protein MIMGU_mgv1a024723mg, partial... 70 3e-11 ref|XP_012843354.1| PREDICTED: AT-rich interactive domain-contai... 67 2e-10 ref|XP_012838998.1| PREDICTED: AT-rich interactive domain-contai... 65 1e-09 ref|XP_011074055.1| AT-rich interactive domain-containing protei... 65 2e-09 >gb|EYU32418.1| hypothetical protein MIMGU_mgv1a024723mg, partial [Erythranthe guttata] Length = 577 Score = 69.7 bits (169), Expect = 3e-11 Identities = 36/54 (66%), Positives = 42/54 (77%) Frame = +1 Query: 205 TKMSNFDVEMEDAEMRSNDSGNNVQESKSDVLDANFESKGEKFPCAAAVSGDVN 366 +KMS DVEMEDAE NDSGNNV+E KS +DA+ E++GEK PC AAVS DVN Sbjct: 1 SKMSKSDVEMEDAEKLPNDSGNNVEEGKS--VDASVETEGEKIPCPAAVSEDVN 52 >ref|XP_012843354.1| PREDICTED: AT-rich interactive domain-containing protein 3-like [Erythranthe guttata] Length = 575 Score = 67.4 bits (163), Expect = 2e-10 Identities = 35/52 (67%), Positives = 40/52 (76%) Frame = +1 Query: 211 MSNFDVEMEDAEMRSNDSGNNVQESKSDVLDANFESKGEKFPCAAAVSGDVN 366 MS DVEMEDAE NDSGNNV+E KS +DA+ E++GEK PC AAVS DVN Sbjct: 1 MSKSDVEMEDAEKLPNDSGNNVEEGKS--VDASVETEGEKIPCPAAVSEDVN 50 >ref|XP_012838998.1| PREDICTED: AT-rich interactive domain-containing protein 3 [Erythranthe guttata] Length = 582 Score = 64.7 bits (156), Expect = 1e-09 Identities = 34/52 (65%), Positives = 38/52 (73%) Frame = +1 Query: 211 MSNFDVEMEDAEMRSNDSGNNVQESKSDVLDANFESKGEKFPCAAAVSGDVN 366 MS DVEMEDAE NDSGNNV+E KS +DA+ E +GEK PC AAV DVN Sbjct: 1 MSKSDVEMEDAEKLPNDSGNNVEEGKS--VDASVEKEGEKIPCPAAVFEDVN 50 >ref|XP_011074055.1| AT-rich interactive domain-containing protein 5 [Sesamum indicum] Length = 763 Score = 64.7 bits (156), Expect = 2e-09 Identities = 33/53 (62%), Positives = 40/53 (75%) Frame = +1 Query: 211 MSNFDVEMEDAEMRSNDSGNNVQESKSDVLDANFESKGEKFPCAAAVSGDVNE 369 MS DVEMEDAE S+DSGN +QES+S V DA E++GEK CAAAV+G N+ Sbjct: 1 MSKSDVEMEDAEKLSHDSGNIIQESESKVTDAEVENEGEKLHCAAAVTGVENK 53