BLASTX nr result
ID: Rehmannia32_contig00019033
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00019033 (557 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIM99386.1| hypothetical protein CDL12_28119 [Handroanthus im... 68 7e-10 >gb|PIM99386.1| hypothetical protein CDL12_28119 [Handroanthus impetiginosus] Length = 659 Score = 67.8 bits (164), Expect = 7e-10 Identities = 33/53 (62%), Positives = 39/53 (73%) Frame = +3 Query: 6 DVSTTEIKMSDADTTSELNTIRNIDARQLKFKYXXXXXXXXXIPILAAFLFQQ 164 D+STT+IK DAD++S LNT+RNIDARQLKFKY IP+ AAFLF Q Sbjct: 607 DLSTTDIKTDDADSSSNLNTVRNIDARQLKFKYIFMVVLVLVIPLFAAFLFLQ 659