BLASTX nr result
ID: Rehmannia32_contig00018181
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00018181 (462 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011070708.1| uncharacterized protein LOC105156309 [Sesamu... 45 5e-06 >ref|XP_011070708.1| uncharacterized protein LOC105156309 [Sesamum indicum] Length = 621 Score = 44.7 bits (104), Expect(2) = 5e-06 Identities = 23/48 (47%), Positives = 28/48 (58%) Frame = +1 Query: 124 DSKSSEEYVEGYENLDSEWNFFDGSENNEMIRPHSRLSKPETQSVVME 267 D K+ + DSEW F SENNEMIRPHS+L KP+ +ME Sbjct: 32 DEKTGNGKLNPPRKSDSEWEFV--SENNEMIRPHSKLPKPQAPPGLME 77 Score = 33.1 bits (74), Expect(2) = 5e-06 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +3 Query: 267 RPRSLPDTFETPAAAIGKFL 326 R RSLP+ ETPA+AIGKF+ Sbjct: 78 RSRSLPENVETPASAIGKFI 97