BLASTX nr result
ID: Rehmannia32_contig00018163
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00018163 (484 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27921.1| hypothetical protein MIMGU_mgv1a012471mg [Erythra... 62 1e-08 gb|EYU27922.1| hypothetical protein MIMGU_mgv1a012471mg [Erythra... 62 1e-08 ref|XP_012848788.1| PREDICTED: stem-specific protein TSJT1-like ... 62 2e-08 ref|XP_003540091.1| PREDICTED: stem-specific protein TSJT1-like ... 60 9e-08 ref|XP_024158120.1| stem-specific protein TSJT1-like [Rosa chine... 59 3e-07 ref|XP_011096244.1| stem-specific protein TSJT1 [Sesamum indicum... 58 5e-07 ref|XP_015899084.1| PREDICTED: stem-specific protein TSJT1-like ... 58 6e-07 ref|XP_023522091.1| stem-specific protein TSJT1-like [Cucurbita ... 58 6e-07 ref|XP_022981300.1| stem-specific protein TSJT1-like [Cucurbita ... 58 6e-07 ref|XP_022940896.1| stem-specific protein TSJT1-like [Cucurbita ... 58 6e-07 ref|XP_021894773.1| stem-specific protein TSJT1 [Carica papaya] 58 6e-07 ref|XP_004141230.1| PREDICTED: stem-specific protein TSJT1 [Cucu... 58 6e-07 ref|XP_010537009.1| PREDICTED: stem-specific protein TSJT1-like ... 58 6e-07 ref|XP_009343576.1| PREDICTED: stem-specific protein TSJT1-like ... 58 6e-07 ref|XP_008366771.1| PREDICTED: stem-specific protein TSJT1-like ... 58 6e-07 gb|PHT49417.1| Stem-specific protein TSJT1 [Capsicum baccatum] 57 7e-07 ref|XP_006413073.1| stem-specific protein TSJT1 [Eutrema salsugi... 57 1e-06 gb|PHT64506.1| hypothetical protein T459_31660 [Capsicum annuum] 57 1e-06 ref|XP_016570493.1| PREDICTED: stem-specific protein TSJT1-like ... 57 1e-06 ref|XP_010487373.1| PREDICTED: stem-specific protein TSJT1-like ... 57 1e-06 >gb|EYU27921.1| hypothetical protein MIMGU_mgv1a012471mg [Erythranthe guttata] Length = 209 Score = 62.0 bits (149), Expect = 1e-08 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -1 Query: 88 NRLFCGVDDVYCIFMGHLNNLCNLNKQYG 2 +RLFCGVDDVYC F+G+LNNLCNLNKQYG Sbjct: 27 DRLFCGVDDVYCTFLGNLNNLCNLNKQYG 55 >gb|EYU27922.1| hypothetical protein MIMGU_mgv1a012471mg [Erythranthe guttata] Length = 193 Score = 61.6 bits (148), Expect = 1e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -1 Query: 85 RLFCGVDDVYCIFMGHLNNLCNLNKQYG 2 RLFCGVDDVYC F+G+LNNLCNLNKQYG Sbjct: 68 RLFCGVDDVYCTFLGNLNNLCNLNKQYG 95 >ref|XP_012848788.1| PREDICTED: stem-specific protein TSJT1-like [Erythranthe guttata] gb|EYU27920.1| hypothetical protein MIMGU_mgv1a012471mg [Erythranthe guttata] Length = 249 Score = 61.6 bits (148), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -1 Query: 85 RLFCGVDDVYCIFMGHLNNLCNLNKQYG 2 RLFCGVDDVYC F+G+LNNLCNLNKQYG Sbjct: 68 RLFCGVDDVYCTFLGNLNNLCNLNKQYG 95 >ref|XP_003540091.1| PREDICTED: stem-specific protein TSJT1-like [Glycine max] gb|KHN23452.1| Stem-specific protein TSJT1 [Glycine soja] gb|KRH26075.1| hypothetical protein GLYMA_12G150500 [Glycine max] Length = 254 Score = 60.1 bits (144), Expect = 9e-08 Identities = 23/28 (82%), Positives = 27/28 (96%) Frame = -1 Query: 85 RLFCGVDDVYCIFMGHLNNLCNLNKQYG 2 RLFCG+DD+YCIF+G LNNLC+LNKQYG Sbjct: 71 RLFCGIDDIYCIFLGSLNNLCSLNKQYG 98 >ref|XP_024158120.1| stem-specific protein TSJT1-like [Rosa chinensis] gb|PRQ31354.1| putative nucleophile aminohydrolase [Rosa chinensis] Length = 255 Score = 58.5 bits (140), Expect = 3e-07 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -1 Query: 94 LCNRLFCGVDDVYCIFMGHLNNLCNLNKQYG 2 L RLFCG DD+YC+F+G+LNNLC LNKQYG Sbjct: 68 LKQRLFCGFDDIYCLFLGNLNNLCTLNKQYG 98 >ref|XP_011096244.1| stem-specific protein TSJT1 [Sesamum indicum] ref|XP_011096245.1| stem-specific protein TSJT1 [Sesamum indicum] ref|XP_011096246.1| stem-specific protein TSJT1 [Sesamum indicum] Length = 252 Score = 58.2 bits (139), Expect = 5e-07 Identities = 23/28 (82%), Positives = 27/28 (96%) Frame = -1 Query: 85 RLFCGVDDVYCIFMGHLNNLCNLNKQYG 2 RLFC VDDV+C+F+G+LNNLCNLNKQYG Sbjct: 71 RLFCSVDDVHCMFLGNLNNLCNLNKQYG 98 >ref|XP_015899084.1| PREDICTED: stem-specific protein TSJT1-like [Ziziphus jujuba] Length = 253 Score = 57.8 bits (138), Expect = 6e-07 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -1 Query: 94 LCNRLFCGVDDVYCIFMGHLNNLCNLNKQYG 2 L RLFCG DD+YC+F+G+LNNLC LNKQYG Sbjct: 67 LQQRLFCGCDDIYCVFLGNLNNLCVLNKQYG 97 >ref|XP_023522091.1| stem-specific protein TSJT1-like [Cucurbita pepo subsp. pepo] Length = 254 Score = 57.8 bits (138), Expect = 6e-07 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = -1 Query: 94 LCNRLFCGVDDVYCIFMGHLNNLCNLNKQYG 2 L RLFCG DD+YC+F+G LNNLC LNKQYG Sbjct: 68 LSQRLFCGFDDIYCLFLGSLNNLCALNKQYG 98 >ref|XP_022981300.1| stem-specific protein TSJT1-like [Cucurbita maxima] Length = 254 Score = 57.8 bits (138), Expect = 6e-07 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = -1 Query: 94 LCNRLFCGVDDVYCIFMGHLNNLCNLNKQYG 2 L RLFCG DD+YC+F+G LNNLC LNKQYG Sbjct: 68 LSQRLFCGFDDIYCLFLGSLNNLCALNKQYG 98 >ref|XP_022940896.1| stem-specific protein TSJT1-like [Cucurbita moschata] Length = 254 Score = 57.8 bits (138), Expect = 6e-07 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = -1 Query: 94 LCNRLFCGVDDVYCIFMGHLNNLCNLNKQYG 2 L RLFCG DD+YC+F+G LNNLC LNKQYG Sbjct: 68 LSQRLFCGFDDIYCLFLGSLNNLCALNKQYG 98 >ref|XP_021894773.1| stem-specific protein TSJT1 [Carica papaya] Length = 254 Score = 57.8 bits (138), Expect = 6e-07 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -1 Query: 94 LCNRLFCGVDDVYCIFMGHLNNLCNLNKQYG 2 L RLFCG DDVYCIF+G LNNLC+LN+QYG Sbjct: 68 LHQRLFCGFDDVYCIFLGALNNLCHLNRQYG 98 >ref|XP_004141230.1| PREDICTED: stem-specific protein TSJT1 [Cucumis sativus] gb|KGN55143.1| hypothetical protein Csa_4G638320 [Cucumis sativus] Length = 254 Score = 57.8 bits (138), Expect = 6e-07 Identities = 22/34 (64%), Positives = 28/34 (82%) Frame = -1 Query: 103 YDMLCNRLFCGVDDVYCIFMGHLNNLCNLNKQYG 2 + ++ RLFCG DD+YC+F+G LNNLC LNKQYG Sbjct: 65 FSLVHQRLFCGFDDIYCLFLGSLNNLCALNKQYG 98 >ref|XP_010537009.1| PREDICTED: stem-specific protein TSJT1-like [Tarenaya hassleriana] Length = 255 Score = 57.8 bits (138), Expect = 6e-07 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = -1 Query: 85 RLFCGVDDVYCIFMGHLNNLCNLNKQYG 2 RLFCG DD+YC+F+G LNNLC+LNKQYG Sbjct: 71 RLFCGFDDIYCLFLGSLNNLCHLNKQYG 98 >ref|XP_009343576.1| PREDICTED: stem-specific protein TSJT1-like [Pyrus x bretschneideri] ref|XP_009351353.1| PREDICTED: stem-specific protein TSJT1-like [Pyrus x bretschneideri] Length = 255 Score = 57.8 bits (138), Expect = 6e-07 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = -1 Query: 85 RLFCGVDDVYCIFMGHLNNLCNLNKQYG 2 RLFCG DD+YC+F+G LNNLC+LNKQYG Sbjct: 72 RLFCGFDDIYCLFLGSLNNLCSLNKQYG 99 >ref|XP_008366771.1| PREDICTED: stem-specific protein TSJT1-like [Malus domestica] Length = 255 Score = 57.8 bits (138), Expect = 6e-07 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = -1 Query: 85 RLFCGVDDVYCIFMGHLNNLCNLNKQYG 2 RLFCG DD+YC+F+G LNNLC+LNKQYG Sbjct: 72 RLFCGFDDIYCLFLGSLNNLCSLNKQYG 99 >gb|PHT49417.1| Stem-specific protein TSJT1 [Capsicum baccatum] Length = 194 Score = 57.0 bits (136), Expect = 7e-07 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = -1 Query: 85 RLFCGVDDVYCIFMGHLNNLCNLNKQYG 2 RLFCGV+D+YCIF+G+LNNLC LNK YG Sbjct: 12 RLFCGVNDIYCIFLGNLNNLCELNKHYG 39 >ref|XP_006413073.1| stem-specific protein TSJT1 [Eutrema salsugineum] gb|ESQ54526.1| hypothetical protein EUTSA_v10026074mg [Eutrema salsugineum] Length = 250 Score = 57.0 bits (136), Expect = 1e-06 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = -1 Query: 85 RLFCGVDDVYCIFMGHLNNLCNLNKQYG 2 RLFCG DD+YC+F G LNNLC+LNKQYG Sbjct: 71 RLFCGFDDIYCLFFGSLNNLCDLNKQYG 98 >gb|PHT64506.1| hypothetical protein T459_31660 [Capsicum annuum] Length = 253 Score = 57.0 bits (136), Expect = 1e-06 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = -1 Query: 85 RLFCGVDDVYCIFMGHLNNLCNLNKQYG 2 RLFCGV+D+YCIF+G+LNNLC LNK YG Sbjct: 71 RLFCGVNDIYCIFLGNLNNLCELNKHYG 98 >ref|XP_016570493.1| PREDICTED: stem-specific protein TSJT1-like [Capsicum annuum] gb|PHU19126.1| hypothetical protein BC332_10277 [Capsicum chinense] Length = 253 Score = 57.0 bits (136), Expect = 1e-06 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = -1 Query: 85 RLFCGVDDVYCIFMGHLNNLCNLNKQYG 2 RLFCGV+D+YCIF+G+LNNLC LNK YG Sbjct: 71 RLFCGVNDIYCIFLGNLNNLCELNKHYG 98 >ref|XP_010487373.1| PREDICTED: stem-specific protein TSJT1-like [Camelina sativa] Length = 253 Score = 57.0 bits (136), Expect = 1e-06 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -1 Query: 94 LCNRLFCGVDDVYCIFMGHLNNLCNLNKQYG 2 L RLFCG+D +YC+F+G LNNLCNLN+QYG Sbjct: 66 LRQRLFCGLDGIYCMFLGRLNNLCNLNRQYG 96