BLASTX nr result
ID: Rehmannia32_contig00018130
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00018130 (504 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN17994.1| hypothetical protein CDL12_09341 [Handroanthus im... 64 2e-10 gb|PIN14385.1| hypothetical protein CDL12_12987 [Handroanthus im... 64 2e-10 gb|KZV57916.1| hypothetical protein F511_12522 [Dorcoceras hygro... 59 4e-08 ref|XP_011073230.1| uncharacterized protein LOC105158253 [Sesamu... 59 4e-08 gb|OIT04480.1| hypothetical protein A4A49_06675 [Nicotiana atten... 55 8e-07 ref|XP_022885671.1| uncharacterized protein LOC111401924 [Olea e... 55 2e-06 >gb|PIN17994.1| hypothetical protein CDL12_09341 [Handroanthus impetiginosus] Length = 86 Score = 64.3 bits (155), Expect = 2e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +2 Query: 398 MALDNVITSPHRRSQTQTAFSPPTLKRQYSRTDEL 502 MALDNVITSPHRRSQTQTAFSPP+ K+Q+SR DEL Sbjct: 1 MALDNVITSPHRRSQTQTAFSPPSSKKQFSRGDEL 35 >gb|PIN14385.1| hypothetical protein CDL12_12987 [Handroanthus impetiginosus] Length = 103 Score = 64.3 bits (155), Expect = 2e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +2 Query: 398 MALDNVITSPHRRSQTQTAFSPPTLKRQYSRTDEL 502 MALDNVITSPHRRSQTQTAFSPP+ K+Q+SR DEL Sbjct: 1 MALDNVITSPHRRSQTQTAFSPPSSKKQFSRGDEL 35 >gb|KZV57916.1| hypothetical protein F511_12522 [Dorcoceras hygrometricum] Length = 102 Score = 58.5 bits (140), Expect = 4e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +2 Query: 398 MALDNVITSPHRRSQTQTAFSPPTLKRQYSRTDEL 502 M LDNVITSPHRR+Q QTAFSP LKRQ+SR +EL Sbjct: 1 MGLDNVITSPHRRTQAQTAFSPQVLKRQHSRVEEL 35 >ref|XP_011073230.1| uncharacterized protein LOC105158253 [Sesamum indicum] ref|XP_011073231.1| uncharacterized protein LOC105158253 [Sesamum indicum] ref|XP_020548385.1| uncharacterized protein LOC105158253 [Sesamum indicum] Length = 103 Score = 58.5 bits (140), Expect = 4e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +2 Query: 398 MALDNVITSPHRRSQTQTAFSPPTLKRQYSRTDEL 502 M LDNVITSPHRR+Q QTAFSPP +KR +SR DEL Sbjct: 1 MPLDNVITSPHRRTQPQTAFSPPLVKRHHSRLDEL 35 >gb|OIT04480.1| hypothetical protein A4A49_06675 [Nicotiana attenuata] Length = 106 Score = 55.1 bits (131), Expect = 8e-07 Identities = 28/35 (80%), Positives = 31/35 (88%), Gaps = 1/35 (2%) Frame = +2 Query: 398 MALDNVITSPHRRSQTQTAF-SPPTLKRQYSRTDE 499 MALD++ITSPHRRSQTQTAF S +LKRQYSR DE Sbjct: 1 MALDSIITSPHRRSQTQTAFSSSASLKRQYSRCDE 35 >ref|XP_022885671.1| uncharacterized protein LOC111401924 [Olea europaea var. sylvestris] Length = 122 Score = 54.7 bits (130), Expect = 2e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +2 Query: 398 MALDNVITSPHRRSQTQTAFSPPTLKRQYSRTDEL 502 MALD+ ITSPHRRSQ QTAFS + K+QYSR+DEL Sbjct: 20 MALDSTITSPHRRSQPQTAFSSSSPKKQYSRSDEL 54