BLASTX nr result
ID: Rehmannia32_contig00018036
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00018036 (379 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN24938.1| hypothetical protein CDL12_02326 [Handroanthus im... 73 1e-14 gb|EYU22464.1| hypothetical protein MIMGU_mgv1a017369mg [Erythra... 56 8e-08 gb|PIN08077.1| putative enzyme related to aldose 1-epimerase [Ha... 58 4e-07 >gb|PIN24938.1| hypothetical protein CDL12_02326 [Handroanthus impetiginosus] Length = 73 Score = 73.2 bits (178), Expect = 1e-14 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +3 Query: 48 MAFRFIAFLACIVFLASVVAAHDGHDHHNMAPGPSPXP 161 MAFRFI +LACIVFLA+VVAAH+GHDHHNMAP P+P P Sbjct: 1 MAFRFITYLACIVFLAAVVAAHEGHDHHNMAPAPAPSP 38 >gb|EYU22464.1| hypothetical protein MIMGU_mgv1a017369mg [Erythranthe guttata] Length = 79 Score = 55.8 bits (133), Expect = 8e-08 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = +3 Query: 51 AFRFIAFLACIVFLASVVAAHDGHDHHNMAPGPSPXPR 164 +FRFI FLACIVFLA+VV AH+GHDH P P+P P+ Sbjct: 3 SFRFITFLACIVFLAAVVVAHEGHDH----PAPAPSPK 36 >gb|PIN08077.1| putative enzyme related to aldose 1-epimerase [Handroanthus impetiginosus] Length = 386 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +3 Query: 48 MAFRFIAFLACIVFLASVVAAHDGHDHHNMAPGPSP 155 MAFRFI +LACIVFLA+ V A + HDHH+M P PSP Sbjct: 1 MAFRFITYLACIVFLAAAVDATEAHDHHHMDPAPSP 36