BLASTX nr result
ID: Rehmannia32_contig00016816
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00016816 (387 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB14312.1| hypothetical protein B456_002G118800 [Gossypium r... 55 5e-06 gb|PNT47202.1| hypothetical protein POPTR_002G012000v3 [Populus ... 54 1e-05 gb|PIA46934.1| hypothetical protein AQUCO_01500455v1 [Aquilegia ... 54 1e-05 >gb|KJB14312.1| hypothetical protein B456_002G118800 [Gossypium raimondii] Length = 588 Score = 54.7 bits (130), Expect = 5e-06 Identities = 33/71 (46%), Positives = 43/71 (60%) Frame = +1 Query: 13 ILQFYIAWQALVGALIPE*DPFAKIFIDHSS*PSGWAYLLCSK*RERLKSGLYSQSYLEN 192 ++ ++ A ALVGAL+PE DP AKI I G + S+ ERL+SGLYS+SYLEN Sbjct: 503 LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSE--ERLESGLYSRSYLEN 560 Query: 193 PYGNCFGWRSI 225 G RS+ Sbjct: 561 QMAVALGGRSV 571 >gb|PNT47202.1| hypothetical protein POPTR_002G012000v3 [Populus trichocarpa] Length = 589 Score = 53.9 bits (128), Expect = 1e-05 Identities = 33/72 (45%), Positives = 43/72 (59%) Frame = +1 Query: 13 ILQFYIAWQALVGALIPE*DPFAKIFIDHSS*PSGWAYLLCSK*RERLKSGLYSQSYLEN 192 ++ ++ A ALVGAL+PE DP AKI I G + S+ ERL+SGLYS+SYLEN Sbjct: 508 LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSE--ERLESGLYSRSYLEN 565 Query: 193 PYGNCFGWRSIL 228 G R +L Sbjct: 566 QMAVALGGRLVL 577 >gb|PIA46934.1| hypothetical protein AQUCO_01500455v1 [Aquilegia coerulea] Length = 611 Score = 53.9 bits (128), Expect = 1e-05 Identities = 33/72 (45%), Positives = 43/72 (59%) Frame = +1 Query: 13 ILQFYIAWQALVGALIPE*DPFAKIFIDHSS*PSGWAYLLCSK*RERLKSGLYSQSYLEN 192 ++ ++ A ALVGAL+PE DP AKI I G + S+ ERL+SGLYS+SYLEN Sbjct: 514 LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSE--ERLESGLYSRSYLEN 571 Query: 193 PYGNCFGWRSIL 228 G R +L Sbjct: 572 QMAVALGGRFVL 583