BLASTX nr result
ID: Rehmannia32_contig00016386
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00016386 (447 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIM99381.1| Serine/threonine protein kinase [Handroanthus imp... 60 5e-08 >gb|PIM99381.1| Serine/threonine protein kinase [Handroanthus impetiginosus] Length = 229 Score = 60.1 bits (144), Expect = 5e-08 Identities = 27/48 (56%), Positives = 37/48 (77%) Frame = -1 Query: 447 DTGLLRDPLAMQGMKDMLAIALSCVKKQPHERPDMKSVLRKLEFMYHK 304 D GLL+DP+ QGM+DMLA+ALSC+ K+ ERP+M V ++ EFM+ K Sbjct: 179 DKGLLKDPVVKQGMRDMLAVALSCLDKKAEERPNMSHVDKEWEFMHTK 226