BLASTX nr result
ID: Rehmannia32_contig00016359
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00016359 (459 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011100264.1| probable serine/threonine-protein kinase At1... 64 9e-09 ref|XP_012852454.1| PREDICTED: probable serine/threonine-protein... 63 1e-08 gb|KZV24382.1| putative serine/threonine-protein kinase-like [Do... 60 1e-07 >ref|XP_011100264.1| probable serine/threonine-protein kinase At1g54610 [Sesamum indicum] Length = 700 Score = 63.5 bits (153), Expect = 9e-09 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +2 Query: 347 KPSSAVKDSEESPKQRELIRKTSELRVARAVSKKRDE 457 KPSSAVK SEESPKQRELI+KTSELR ARA+S KRDE Sbjct: 7 KPSSAVKASEESPKQRELIKKTSELREARAISSKRDE 43 >ref|XP_012852454.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 [Erythranthe guttata] gb|EYU24917.1| hypothetical protein MIMGU_mgv1a002276mg [Erythranthe guttata] Length = 692 Score = 63.2 bits (152), Expect = 1e-08 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +2 Query: 347 KPSSAVKDSEESPKQRELIRKTSELRVARAVSKKRDE 457 KPSSAVK+S +SPKQREL+RKTSELRVARA+S KRDE Sbjct: 7 KPSSAVKNSGDSPKQRELMRKTSELRVARAISSKRDE 43 >gb|KZV24382.1| putative serine/threonine-protein kinase-like [Dorcoceras hygrometricum] Length = 696 Score = 60.5 bits (145), Expect = 1e-07 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +2 Query: 347 KPSSAVKDSEESPKQRELIRKTSELRVARAVSKKRDE 457 K SS KDSEESPKQRELIRKTSELR ARA+S KRDE Sbjct: 7 KTSSVSKDSEESPKQRELIRKTSELRGARAISSKRDE 43