BLASTX nr result
ID: Rehmannia32_contig00016314
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00016314 (457 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022961459.1| hydrophobic protein LTI6B-like [Cucurbita mo... 77 8e-16 gb|PIA37878.1| hypothetical protein AQUCO_02900013v1 [Aquilegia ... 77 8e-16 gb|OWM72375.1| hypothetical protein CDL15_Pgr018260 [Punica gran... 77 8e-16 ref|XP_018676027.1| PREDICTED: hydrophobic protein LTI6B-like [M... 76 2e-15 gb|KGN65991.1| hypothetical protein Csa_1G560745 [Cucumis sativus] 76 2e-15 ref|XP_018856461.1| PREDICTED: hydrophobic protein RCI2B-like [J... 75 2e-15 ref|XP_004494506.1| PREDICTED: hydrophobic protein LTI6B-like [C... 75 2e-15 ref|XP_020685851.1| hydrophobic protein LTI6B [Dendrobium catena... 75 3e-15 gb|ACA66247.1| cold-induced plasma membrane protein [Musa ABB Gr... 75 3e-15 gb|KQL03570.1| hypothetical protein SETIT_003690mg [Setaria ital... 75 3e-15 ref|XP_009335544.1| PREDICTED: hydrophobic protein LTI6B-like [P... 75 3e-15 ref|NP_001151840.1| hydrophobic protein LTI6B [Zea mays] >gi|226... 75 3e-15 ref|XP_022867814.1| hydrophobic protein LTI6B-like [Olea europae... 75 3e-15 gb|PAN31206.1| hypothetical protein PAHAL_E03252 [Panicum hallii] 75 4e-15 ref|XP_020267271.1| hydrophobic protein LTI6B [Asparagus officin... 75 4e-15 dbj|GAU11402.1| hypothetical protein TSUD_343930 [Trifolium subt... 75 4e-15 ref|NP_001147508.1| uncharacterized protein LOC100281117 [Zea ma... 75 4e-15 ref|XP_006428347.1| hydrophobic protein RCI2B [Citrus clementina... 75 5e-15 ref|XP_020575782.1| hydrophobic protein LTI6B [Phalaenopsis eque... 75 6e-15 gb|ABK22915.1| unknown [Picea sitchensis] >gi|116790796|gb|ABK25... 74 7e-15 >ref|XP_022961459.1| hydrophobic protein LTI6B-like [Cucurbita moschata] ref|XP_022968842.1| hydrophobic protein LTI6B-like [Cucurbita maxima] ref|XP_023539025.1| hydrophobic protein LTI6B-like [Cucurbita pepo subsp. pepo] Length = 57 Score = 76.6 bits (187), Expect = 8e-16 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -1 Query: 388 GTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 281 GTANC+DI+LAILLPPLGVFLKFGCQVEFWICL+LT Sbjct: 5 GTANCIDILLAILLPPLGVFLKFGCQVEFWICLVLT 40 >gb|PIA37878.1| hypothetical protein AQUCO_02900013v1 [Aquilegia coerulea] Length = 57 Score = 76.6 bits (187), Expect = 8e-16 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -1 Query: 391 QGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 281 QGTANC+DI+LAI LPPLGVFLKFGC+VEFWICLLLT Sbjct: 4 QGTANCIDILLAIFLPPLGVFLKFGCKVEFWICLLLT 40 >gb|OWM72375.1| hypothetical protein CDL15_Pgr018260 [Punica granatum] Length = 57 Score = 76.6 bits (187), Expect = 8e-16 Identities = 32/37 (86%), Positives = 37/37 (100%) Frame = -1 Query: 391 QGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 281 +GTANC+DIILAI+LPPLGVFLKFGC++EFWICLLLT Sbjct: 4 EGTANCIDIILAIILPPLGVFLKFGCKIEFWICLLLT 40 >ref|XP_018676027.1| PREDICTED: hydrophobic protein LTI6B-like [Musa acuminata subsp. malaccensis] Length = 57 Score = 75.9 bits (185), Expect = 2e-15 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -1 Query: 391 QGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 281 +GT NC+DI++AILLPPLGVFLKFGCQVEFWICLLLT Sbjct: 4 EGTVNCIDILVAILLPPLGVFLKFGCQVEFWICLLLT 40 >gb|KGN65991.1| hypothetical protein Csa_1G560745 [Cucumis sativus] Length = 57 Score = 75.9 bits (185), Expect = 2e-15 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -1 Query: 391 QGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 281 +GT NC+DI+LAILLPPLGVFLKFGCQVEFWICL+LT Sbjct: 4 EGTTNCIDILLAILLPPLGVFLKFGCQVEFWICLVLT 40 >ref|XP_018856461.1| PREDICTED: hydrophobic protein RCI2B-like [Juglans regia] Length = 57 Score = 75.5 bits (184), Expect = 2e-15 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -1 Query: 391 QGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 281 +GTA C+DI+LAI+LPPLGVFLKFGCQVEFWICLLLT Sbjct: 4 EGTATCIDILLAIILPPLGVFLKFGCQVEFWICLLLT 40 >ref|XP_004494506.1| PREDICTED: hydrophobic protein LTI6B-like [Cicer arietinum] Length = 57 Score = 75.5 bits (184), Expect = 2e-15 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -1 Query: 391 QGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 281 +GTANC+DI+LAILLPPLGVFLKFGC VEFWICL+LT Sbjct: 4 EGTANCIDILLAILLPPLGVFLKFGCHVEFWICLVLT 40 >ref|XP_020685851.1| hydrophobic protein LTI6B [Dendrobium catenatum] gb|PKU59352.1| Hydrophobic protein LTI6B [Dendrobium catenatum] Length = 56 Score = 75.1 bits (183), Expect = 3e-15 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 388 GTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 281 GTANCVDIILAI+LPPLGVFLKFGC+ EFWICLLLT Sbjct: 4 GTANCVDIILAIILPPLGVFLKFGCKAEFWICLLLT 39 >gb|ACA66247.1| cold-induced plasma membrane protein [Musa ABB Group] Length = 57 Score = 75.1 bits (183), Expect = 3e-15 Identities = 31/37 (83%), Positives = 37/37 (100%) Frame = -1 Query: 391 QGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 281 +GTANC+DI+LAI+LPPLGVFLKFGC++EFWICLLLT Sbjct: 4 KGTANCIDILLAIILPPLGVFLKFGCEMEFWICLLLT 40 >gb|KQL03570.1| hypothetical protein SETIT_003690mg [Setaria italica] gb|KQL03571.1| hypothetical protein SETIT_003690mg [Setaria italica] Length = 57 Score = 75.1 bits (183), Expect = 3e-15 Identities = 31/37 (83%), Positives = 37/37 (100%) Frame = -1 Query: 391 QGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 281 +GTANCVDI++AI+LPPLGVFLKFGC+VEFW+CLLLT Sbjct: 3 EGTANCVDILIAIILPPLGVFLKFGCKVEFWLCLLLT 39 >ref|XP_009335544.1| PREDICTED: hydrophobic protein LTI6B-like [Pyrus x bretschneideri] Length = 57 Score = 75.1 bits (183), Expect = 3e-15 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -1 Query: 391 QGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 281 +GT NCVDI+LAILLPPLGVFLKFGC VEFWICLLLT Sbjct: 4 EGTLNCVDILLAILLPPLGVFLKFGCHVEFWICLLLT 40 >ref|NP_001151840.1| hydrophobic protein LTI6B [Zea mays] ref|NP_001152948.1| hydrophobic protein LTI6B [Zea mays] ref|XP_020405382.1| hydrophobic protein LTI6B isoform X1 [Zea mays] gb|ACG43609.1| hydrophobic protein LTI6B [Zea mays] gb|ACG44549.1| hydrophobic protein LTI6B [Zea mays] gb|KXG32309.1| hypothetical protein SORBI_3003G137400 [Sorghum bicolor] gb|ONM31521.1| Hydrophobic protein LTI6B [Zea mays] Length = 57 Score = 75.1 bits (183), Expect = 3e-15 Identities = 31/37 (83%), Positives = 37/37 (100%) Frame = -1 Query: 391 QGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 281 +GTANCVDI++AI+LPPLGVFLKFGC+VEFW+CLLLT Sbjct: 3 EGTANCVDILIAIILPPLGVFLKFGCKVEFWLCLLLT 39 >ref|XP_022867814.1| hydrophobic protein LTI6B-like [Olea europaea var. sylvestris] Length = 58 Score = 75.1 bits (183), Expect = 3e-15 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -1 Query: 391 QGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 281 +GT NC+DI+LAILLPPLGVFLKFGC+VEFWICLLLT Sbjct: 4 EGTLNCIDILLAILLPPLGVFLKFGCKVEFWICLLLT 40 >gb|PAN31206.1| hypothetical protein PAHAL_E03252 [Panicum hallii] Length = 56 Score = 74.7 bits (182), Expect = 4e-15 Identities = 30/37 (81%), Positives = 37/37 (100%) Frame = -1 Query: 391 QGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 281 +GTANC+DI++AI+LPPLGVFLKFGC+VEFW+CLLLT Sbjct: 3 EGTANCIDILIAIILPPLGVFLKFGCKVEFWLCLLLT 39 >ref|XP_020267271.1| hydrophobic protein LTI6B [Asparagus officinalis] Length = 57 Score = 74.7 bits (182), Expect = 4e-15 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -1 Query: 391 QGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 281 +GTANC+DIILAI+LPPLGVFLKFGC VEFWICL+LT Sbjct: 4 EGTANCIDIILAIILPPLGVFLKFGCGVEFWICLVLT 40 >dbj|GAU11402.1| hypothetical protein TSUD_343930 [Trifolium subterraneum] gb|PNX74370.1| hydrophobic protein LTI6A-like [Trifolium pratense] Length = 57 Score = 74.7 bits (182), Expect = 4e-15 Identities = 31/37 (83%), Positives = 36/37 (97%) Frame = -1 Query: 391 QGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 281 +GTANC+DI+LAI+LPPLGVFLKFGC VEFWICL+LT Sbjct: 4 EGTANCIDILLAIILPPLGVFLKFGCNVEFWICLVLT 40 >ref|NP_001147508.1| uncharacterized protein LOC100281117 [Zea mays] gb|ACG27760.1| hydrophobic protein LTI6B [Zea mays] gb|AQK89177.1| Hydrophobic protein LTI6B [Zea mays] Length = 57 Score = 74.7 bits (182), Expect = 4e-15 Identities = 30/37 (81%), Positives = 37/37 (100%) Frame = -1 Query: 391 QGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 281 +GTANC+DI++AI+LPPLGVFLKFGC+VEFW+CLLLT Sbjct: 3 EGTANCIDILIAIILPPLGVFLKFGCKVEFWLCLLLT 39 >ref|XP_006428347.1| hydrophobic protein RCI2B [Citrus clementina] ref|XP_006480340.1| PREDICTED: hydrophobic protein RCI2B [Citrus sinensis] gb|ESR41586.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gb|ESR41587.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gb|KDO56401.1| hypothetical protein CISIN_1g035460mg [Citrus sinensis] gb|KDO56402.1| hypothetical protein CISIN_1g035460mg [Citrus sinensis] Length = 58 Score = 74.7 bits (182), Expect = 5e-15 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -1 Query: 391 QGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 281 +GTA C+DIILAI+LPPLGVFLKFGC+VEFWICLLLT Sbjct: 4 EGTATCIDIILAIILPPLGVFLKFGCKVEFWICLLLT 40 >ref|XP_020575782.1| hydrophobic protein LTI6B [Phalaenopsis equestris] Length = 83 Score = 75.1 bits (183), Expect = 6e-15 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = -1 Query: 400 KKWQGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 281 K +GTANC+DI+LAI+LPPLGVFLKFGC+ EFWICLLLT Sbjct: 27 KMSEGTANCIDILLAIILPPLGVFLKFGCKAEFWICLLLT 66 >gb|ABK22915.1| unknown [Picea sitchensis] gb|ABK25743.1| unknown [Picea sitchensis] gb|ADM76850.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76851.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76852.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76853.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76854.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76855.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76856.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76857.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76858.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76859.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76860.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76861.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76862.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76863.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76864.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76865.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76866.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76867.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76868.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76869.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76870.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76871.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76872.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76873.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76874.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76875.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76876.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76877.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76878.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76879.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76880.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76881.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76882.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76883.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76884.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76885.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76886.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76887.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76888.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76889.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76890.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76891.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76892.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76893.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76894.1| low temprature induced-like protein [Picea sitchensis] gb|ADM76895.1| low temprature induced-like protein [Picea sitchensis] Length = 59 Score = 74.3 bits (181), Expect = 7e-15 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -1 Query: 391 QGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 281 +GTANCVDIILAI+LPP+GVFLKFGC EFWICLLLT Sbjct: 3 EGTANCVDIILAIILPPVGVFLKFGCHAEFWICLLLT 39