BLASTX nr result
ID: Rehmannia32_contig00016206
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00016206 (654 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS70525.1| hypothetical protein M569_04233, partial [Genlise... 66 1e-09 gb|OTG06612.1| putative rad21/Rec8-like protein [Helianthus annuus] 63 2e-09 ref|XP_002987017.1| hypothetical protein SELMODRAFT_125174 [Sela... 63 1e-08 ref|XP_002985553.1| hypothetical protein SELMODRAFT_122410 [Sela... 63 1e-08 gb|AKJ50987.1| XYh8Y, partial [Carica papaya] 63 1e-08 gb|AKJ50951.1| XYh8Y, partial [Carica papaya] 63 1e-08 gb|AKJ50931.1| XYh8Y, partial [Carica papaya] >gi|826566563|gb|A... 63 1e-08 gb|PKI45119.1| hypothetical protein CRG98_034503 [Punica granatum] 63 1e-08 gb|KJB14904.1| hypothetical protein B456_002G148100 [Gossypium r... 63 1e-08 gb|PRQ41479.1| putative rad21/Rec8-like protein [Rosa chinensis] 63 2e-08 ref|XP_022893065.1| sister chromatid cohesion 1 protein 4-like [... 63 2e-08 ref|XP_021973111.1| sister chromatid cohesion 1 protein 4-like [... 63 2e-08 ref|XP_002989794.1| hypothetical protein SELMODRAFT_6910, partia... 60 3e-08 ref|XP_002990129.1| hypothetical protein SELMODRAFT_6909, partia... 60 3e-08 ref|XP_001765550.1| predicted protein [Physcomitrella patens] 60 3e-08 gb|AQK98982.1| Sister chromatid cohesion 1 protein 4, partial [Z... 63 4e-08 gb|PHT99963.1| Sister chromatid cohesion 1 protein 4 [Capsicum c... 64 5e-08 gb|AAD29702.1|AF140489_1 kiaa0078 protein, partial [Oryza sativa] 61 5e-08 gb|AOR06529.1| cohesin subunit Rad21-1, partial [Luzula elegans] 63 5e-08 gb|ABR18449.1| unknown [Picea sitchensis] 63 6e-08 >gb|EPS70525.1| hypothetical protein M569_04233, partial [Genlisea aurea] Length = 193 Score = 65.9 bits (159), Expect = 1e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 106 KRGTGKMFYSQFILAKKGPLGTIWIAAHLERKLRK 2 K G+ +MFYSQFILAKKGPLGTIWIAAHLERKLRK Sbjct: 5 KGGSVEMFYSQFILAKKGPLGTIWIAAHLERKLRK 39 >gb|OTG06612.1| putative rad21/Rec8-like protein [Helianthus annuus] Length = 84 Score = 62.8 bits (151), Expect = 2e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 88 MFYSQFILAKKGPLGTIWIAAHLERKLRK 2 MFYSQFILAKKGPLGTIWIAAHLERKLRK Sbjct: 1 MFYSQFILAKKGPLGTIWIAAHLERKLRK 29 >ref|XP_002987017.1| hypothetical protein SELMODRAFT_125174 [Selaginella moellendorffii] gb|EFJ11860.1| hypothetical protein SELMODRAFT_125174 [Selaginella moellendorffii] Length = 172 Score = 62.8 bits (151), Expect = 1e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 88 MFYSQFILAKKGPLGTIWIAAHLERKLRK 2 MFYSQFILAKKGPLGTIWIAAHLERKLRK Sbjct: 1 MFYSQFILAKKGPLGTIWIAAHLERKLRK 29 >ref|XP_002985553.1| hypothetical protein SELMODRAFT_122410 [Selaginella moellendorffii] gb|EFJ13427.1| hypothetical protein SELMODRAFT_122410 [Selaginella moellendorffii] Length = 173 Score = 62.8 bits (151), Expect = 1e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 88 MFYSQFILAKKGPLGTIWIAAHLERKLRK 2 MFYSQFILAKKGPLGTIWIAAHLERKLRK Sbjct: 1 MFYSQFILAKKGPLGTIWIAAHLERKLRK 29 >gb|AKJ50987.1| XYh8Y, partial [Carica papaya] Length = 178 Score = 62.8 bits (151), Expect = 1e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 88 MFYSQFILAKKGPLGTIWIAAHLERKLRK 2 MFYSQFILAKKGPLGTIWIAAHLERKLRK Sbjct: 1 MFYSQFILAKKGPLGTIWIAAHLERKLRK 29 >gb|AKJ50951.1| XYh8Y, partial [Carica papaya] Length = 178 Score = 62.8 bits (151), Expect = 1e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 88 MFYSQFILAKKGPLGTIWIAAHLERKLRK 2 MFYSQFILAKKGPLGTIWIAAHLERKLRK Sbjct: 1 MFYSQFILAKKGPLGTIWIAAHLERKLRK 29 >gb|AKJ50931.1| XYh8Y, partial [Carica papaya] gb|AKJ50935.1| XYh8Y, partial [Carica papaya] gb|AKJ50939.1| XYh8Y, partial [Carica papaya] gb|AKJ50943.1| XYh8Y, partial [Carica papaya] gb|AKJ50947.1| XYh8Y, partial [Carica papaya] gb|AKJ50955.1| XYh8Y, partial [Carica papaya] gb|AKJ50959.1| XYh8Y, partial [Carica papaya] gb|AKJ50963.1| XYh8Y, partial [Carica papaya] gb|AKJ50967.1| XYh8Y, partial [Carica papaya] gb|AKJ50971.1| XYh8Y, partial [Carica papaya] gb|AKJ50975.1| XYh8Y, partial [Carica papaya] gb|AKJ50979.1| XYh8Y, partial [Carica papaya] gb|AKJ50983.1| XYh8Y, partial [Carica papaya] gb|AKJ50991.1| XYh8Y, partial [Carica papaya] gb|AKJ50995.1| XYh8Y, partial [Carica papaya] gb|AKJ50999.1| XYh8Y, partial [Carica papaya] gb|AKJ51003.1| XYh8Y, partial [Carica papaya] gb|AKJ51007.1| XYh8Y, partial [Carica papaya] gb|AKJ51011.1| XYh8Y, partial [Carica papaya] gb|AKJ51015.1| XYh8Y, partial [Carica papaya] gb|AKJ51019.1| XYh8Y, partial [Carica papaya] gb|AKJ51023.1| XYh8Y, partial [Carica papaya] gb|AKJ51027.1| XYh8Y, partial [Carica papaya] gb|AKJ51031.1| XYh8Y, partial [Carica papaya] gb|AKJ51035.1| XYh8Y, partial [Carica papaya] gb|AKJ51039.1| XYh8Y, partial [Carica papaya] gb|AKJ51043.1| XYh8Y, partial [Carica papaya] gb|AKJ51047.1| XYh8Y, partial [Carica papaya] gb|AKJ51051.1| XYh8Y, partial [Carica papaya] gb|AKJ51055.1| XYh8Y, partial [Carica papaya] gb|AKJ51059.1| XYh8Y, partial [Carica papaya] gb|AKJ51063.1| XYh8Y, partial [Carica papaya] gb|AKJ51067.1| XYh8Y, partial [Carica papaya] gb|AKJ51071.1| XYh8Y, partial [Carica papaya] gb|AKJ51075.1| XYh8Y, partial [Carica papaya] gb|AKJ51079.1| XYh8Y, partial [Carica papaya] gb|AKJ51083.1| XYh8Y, partial [Carica papaya] gb|AKJ51087.1| XYh8Y, partial [Carica papaya] gb|AKJ51091.1| XYh8Y, partial [Carica papaya] gb|AKJ51095.1| XYh8Y, partial [Carica papaya] gb|AKJ51099.1| XYh8Y, partial [Carica papaya] gb|AKJ51103.1| XYh8Y, partial [Carica papaya] gb|AKJ51107.1| XYh8Y, partial [Carica papaya] gb|AKJ51111.1| XYh8Y, partial [Carica papaya] gb|AKJ51115.1| XYh8Y, partial [Carica papaya] Length = 178 Score = 62.8 bits (151), Expect = 1e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 88 MFYSQFILAKKGPLGTIWIAAHLERKLRK 2 MFYSQFILAKKGPLGTIWIAAHLERKLRK Sbjct: 1 MFYSQFILAKKGPLGTIWIAAHLERKLRK 29 >gb|PKI45119.1| hypothetical protein CRG98_034503 [Punica granatum] Length = 186 Score = 62.8 bits (151), Expect = 1e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 88 MFYSQFILAKKGPLGTIWIAAHLERKLRK 2 MFYSQFILAKKGPLGTIWIAAHLERKLRK Sbjct: 1 MFYSQFILAKKGPLGTIWIAAHLERKLRK 29 >gb|KJB14904.1| hypothetical protein B456_002G148100 [Gossypium raimondii] Length = 188 Score = 62.8 bits (151), Expect = 1e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 88 MFYSQFILAKKGPLGTIWIAAHLERKLRK 2 MFYSQFILAKKGPLGTIWIAAHLERKLRK Sbjct: 1 MFYSQFILAKKGPLGTIWIAAHLERKLRK 29 >gb|PRQ41479.1| putative rad21/Rec8-like protein [Rosa chinensis] Length = 195 Score = 62.8 bits (151), Expect = 2e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 88 MFYSQFILAKKGPLGTIWIAAHLERKLRK 2 MFYSQFILAKKGPLGTIWIAAHLERKLRK Sbjct: 1 MFYSQFILAKKGPLGTIWIAAHLERKLRK 29 >ref|XP_022893065.1| sister chromatid cohesion 1 protein 4-like [Olea europaea var. sylvestris] Length = 197 Score = 62.8 bits (151), Expect = 2e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 88 MFYSQFILAKKGPLGTIWIAAHLERKLRK 2 MFYSQFILAKKGPLGTIWIAAHLERKLRK Sbjct: 1 MFYSQFILAKKGPLGTIWIAAHLERKLRK 29 >ref|XP_021973111.1| sister chromatid cohesion 1 protein 4-like [Helianthus annuus] Length = 212 Score = 62.8 bits (151), Expect = 2e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 88 MFYSQFILAKKGPLGTIWIAAHLERKLRK 2 MFYSQFILAKKGPLGTIWIAAHLERKLRK Sbjct: 1 MFYSQFILAKKGPLGTIWIAAHLERKLRK 29 >ref|XP_002989794.1| hypothetical protein SELMODRAFT_6910, partial [Selaginella moellendorffii] gb|EFJ09061.1| hypothetical protein SELMODRAFT_6910, partial [Selaginella moellendorffii] Length = 123 Score = 60.5 bits (145), Expect = 3e-08 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -3 Query: 88 MFYSQFILAKKGPLGTIWIAAHLERKLRK 2 MFYSQ+ILAKKGPLGTIWIAAHLE+KLRK Sbjct: 1 MFYSQYILAKKGPLGTIWIAAHLEKKLRK 29 >ref|XP_002990129.1| hypothetical protein SELMODRAFT_6909, partial [Selaginella moellendorffii] gb|EFJ08846.1| hypothetical protein SELMODRAFT_6909, partial [Selaginella moellendorffii] Length = 123 Score = 60.5 bits (145), Expect = 3e-08 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -3 Query: 88 MFYSQFILAKKGPLGTIWIAAHLERKLRK 2 MFYSQ+ILAKKGPLGTIWIAAHLE+KLRK Sbjct: 1 MFYSQYILAKKGPLGTIWIAAHLEKKLRK 29 >ref|XP_001765550.1| predicted protein [Physcomitrella patens] Length = 125 Score = 60.5 bits (145), Expect = 3e-08 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 88 MFYSQFILAKKGPLGTIWIAAHLERKLRK 2 MFYSQ ILAKKGPLGTIWIAAHLERKLRK Sbjct: 1 MFYSQLILAKKGPLGTIWIAAHLERKLRK 29 >gb|AQK98982.1| Sister chromatid cohesion 1 protein 4, partial [Zea mays] Length = 274 Score = 62.8 bits (151), Expect = 4e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 88 MFYSQFILAKKGPLGTIWIAAHLERKLRK 2 MFYSQFILAKKGPLGTIWIAAHLERKLRK Sbjct: 1 MFYSQFILAKKGPLGTIWIAAHLERKLRK 29 >gb|PHT99963.1| Sister chromatid cohesion 1 protein 4 [Capsicum chinense] Length = 1370 Score = 63.5 bits (153), Expect = 5e-08 Identities = 31/36 (86%), Positives = 33/36 (91%), Gaps = 1/36 (2%) Frame = -3 Query: 106 KRGTGK-MFYSQFILAKKGPLGTIWIAAHLERKLRK 2 + G G+ MFYSQFILAKKGPLGTIWIAAHLERKLRK Sbjct: 110 RSGEGREMFYSQFILAKKGPLGTIWIAAHLERKLRK 145 >gb|AAD29702.1|AF140489_1 kiaa0078 protein, partial [Oryza sativa] Length = 169 Score = 60.8 bits (146), Expect = 5e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 85 FYSQFILAKKGPLGTIWIAAHLERKLRK 2 FYSQFILAKKGPLGTIWIAAHLERKLRK Sbjct: 1 FYSQFILAKKGPLGTIWIAAHLERKLRK 28 >gb|AOR06529.1| cohesin subunit Rad21-1, partial [Luzula elegans] Length = 330 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 88 MFYSQFILAKKGPLGTIWIAAHLERKLRK 2 MFYSQFILAKKGPLGTIWIAAHLERKLRK Sbjct: 1 MFYSQFILAKKGPLGTIWIAAHLERKLRK 29 >gb|ABR18449.1| unknown [Picea sitchensis] Length = 355 Score = 62.8 bits (151), Expect = 6e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 88 MFYSQFILAKKGPLGTIWIAAHLERKLRK 2 MFYSQFILAKKGPLGTIWIAAHLERKLRK Sbjct: 1 MFYSQFILAKKGPLGTIWIAAHLERKLRK 29