BLASTX nr result
ID: Rehmannia32_contig00016002
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00016002 (465 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN19497.1| Calcium/calmodulin-dependent protein kinase [Hand... 62 2e-08 ref|XP_011077860.1| uncharacterized protein LOC105161756 [Sesamu... 60 7e-08 ref|XP_012836123.1| PREDICTED: uncharacterized protein LOC105956... 60 1e-07 gb|EYU35502.1| hypothetical protein MIMGU_mgv1a011570mg [Erythra... 58 6e-07 ref|XP_012839686.1| PREDICTED: uncharacterized protein LOC105960... 58 7e-07 >gb|PIN19497.1| Calcium/calmodulin-dependent protein kinase [Handroanthus impetiginosus] Length = 301 Score = 62.4 bits (150), Expect = 2e-08 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = -3 Query: 463 HRKPSRSGSRKVVEVLMEEPVGVEPQRRSVSVKVREVPV 347 H+KP+RSGS KVVEVLMEEP VEPQR+SV+V+V E+PV Sbjct: 217 HKKPARSGSSKVVEVLMEEPEDVEPQRKSVNVRVPEIPV 255 >ref|XP_011077860.1| uncharacterized protein LOC105161756 [Sesamum indicum] Length = 294 Score = 60.5 bits (145), Expect = 7e-08 Identities = 30/40 (75%), Positives = 31/40 (77%) Frame = -3 Query: 463 HRKPSRSGSRKVVEVLMEEPVGVEPQRRSVSVKVREVPVG 344 HRKP RSGSRK VEVL EEPV VEPQR SVS K R +P G Sbjct: 215 HRKPVRSGSRKTVEVLEEEPVVVEPQRESVSPKARGIPAG 254 >ref|XP_012836123.1| PREDICTED: uncharacterized protein LOC105956772 [Erythranthe guttata] gb|EYU38640.1| hypothetical protein MIMGU_mgv1a010487mg [Erythranthe guttata] Length = 310 Score = 60.1 bits (144), Expect = 1e-07 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 4/44 (9%) Frame = -3 Query: 463 HRKPSRSGSRKVVEVLMEEP--VGV--EPQRRSVSVKVREVPVG 344 HRKPSRSGSRKVVEV E P VGV EPQR+SVS++VRE+PVG Sbjct: 215 HRKPSRSGSRKVVEVTEEPPPAVGVVAEPQRKSVSLRVREIPVG 258 >gb|EYU35502.1| hypothetical protein MIMGU_mgv1a011570mg [Erythranthe guttata] Length = 277 Score = 57.8 bits (138), Expect = 6e-07 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -3 Query: 463 HRKPSRSGSRKVVEVLMEEPVGVEPQRRSVSVKVREV 353 HRK SRSGSRKV+EV+MEE V VEP R+SVSVKVRE+ Sbjct: 213 HRKNSRSGSRKVMEVVMEEAVVVEPLRKSVSVKVREI 249 >ref|XP_012839686.1| PREDICTED: uncharacterized protein LOC105960063 [Erythranthe guttata] Length = 296 Score = 57.8 bits (138), Expect = 7e-07 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -3 Query: 463 HRKPSRSGSRKVVEVLMEEPVGVEPQRRSVSVKVREV 353 HRK SRSGSRKV+EV+MEE V VEP R+SVSVKVRE+ Sbjct: 213 HRKNSRSGSRKVMEVVMEEAVVVEPLRKSVSVKVREI 249