BLASTX nr result
ID: Rehmannia32_contig00014603
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00014603 (600 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN01402.1| Sentrin-specific cysteine protease (Ulp1 family) ... 61 1e-07 gb|KZV35133.1| hypothetical protein F511_06839 [Dorcoceras hygro... 59 3e-07 ref|XP_012838650.1| PREDICTED: NEDD8-specific protease 1 [Erythr... 59 5e-07 ref|XP_011089365.1| NEDD8-specific protease 1 isoform X2 [Sesamu... 57 2e-06 ref|XP_020552283.1| NEDD8-specific protease 1 isoform X1 [Sesamu... 57 2e-06 ref|XP_022893104.1| NEDD8-specific protease 1 [Olea europaea var... 55 1e-05 >gb|PIN01402.1| Sentrin-specific cysteine protease (Ulp1 family) [Handroanthus impetiginosus] Length = 241 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/41 (65%), Positives = 36/41 (87%) Frame = +3 Query: 3 EGPKDMEELWFSAIKGKVTPSLVSKMRNEILELVRTLMVKQ 125 +G K++E+LWFS IK ++TPS VSKMRN++LELVR+LM KQ Sbjct: 201 DGLKNLEDLWFSTIKEQITPSFVSKMRNDMLELVRSLMAKQ 241 >gb|KZV35133.1| hypothetical protein F511_06839 [Dorcoceras hygrometricum] Length = 226 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/38 (71%), Positives = 35/38 (92%) Frame = +3 Query: 12 KDMEELWFSAIKGKVTPSLVSKMRNEILELVRTLMVKQ 125 K+ +ELWFSA+K ++TP LVSKMRNEILELV++LMVK+ Sbjct: 187 KNAKELWFSAVKERITPFLVSKMRNEILELVQSLMVKE 224 >ref|XP_012838650.1| PREDICTED: NEDD8-specific protease 1 [Erythranthe guttata] gb|EYU36216.1| hypothetical protein MIMGU_mgv1a013020mg [Erythranthe guttata] Length = 233 Score = 58.9 bits (141), Expect = 5e-07 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = +3 Query: 15 DMEELWFSAIKGKVTPSLVSKMRNEILELVRTLMVKQ*NGI 137 +ME LWFS I+ ++TPSLV+ MRNEILELVR LMVKQ N + Sbjct: 190 NMESLWFSTIEEQITPSLVTNMRNEILELVRNLMVKQENRV 230 >ref|XP_011089365.1| NEDD8-specific protease 1 isoform X2 [Sesamum indicum] ref|XP_011089366.1| NEDD8-specific protease 1 isoform X2 [Sesamum indicum] ref|XP_020552284.1| NEDD8-specific protease 1 isoform X2 [Sesamum indicum] ref|XP_020552285.1| NEDD8-specific protease 1 isoform X2 [Sesamum indicum] ref|XP_020552286.1| NEDD8-specific protease 1 isoform X2 [Sesamum indicum] Length = 223 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = +3 Query: 9 PKDMEELWFSAIKGKVTPSLVSKMRNEILELVRTLMVKQ 125 P+ ++LWF+AIK ++TPS VSKMRN+ILELVR+LM KQ Sbjct: 185 PRGTDDLWFAAIKEQITPSHVSKMRNDILELVRSLMSKQ 223 >ref|XP_020552283.1| NEDD8-specific protease 1 isoform X1 [Sesamum indicum] Length = 235 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = +3 Query: 9 PKDMEELWFSAIKGKVTPSLVSKMRNEILELVRTLMVKQ 125 P+ ++LWF+AIK ++TPS VSKMRN+ILELVR+LM KQ Sbjct: 197 PRGTDDLWFAAIKEQITPSHVSKMRNDILELVRSLMSKQ 235 >ref|XP_022893104.1| NEDD8-specific protease 1 [Olea europaea var. sylvestris] Length = 224 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = +3 Query: 3 EGPKDMEELWFSAIKGKVTPSLVSKMRNEILELVRTLMVKQ 125 +GPKD E+LWF AIK +V+P VS MR+ ILEL+R+LM Q Sbjct: 184 DGPKDSEDLWFCAIKEQVSPFAVSDMRSSILELIRSLMANQ 224