BLASTX nr result
ID: Rehmannia32_contig00014579
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00014579 (533 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011079874.1| uncharacterized protein LOC105163283 [Sesamu... 96 2e-21 gb|PIN14563.1| hypothetical protein CDL12_12797 [Handroanthus im... 92 4e-21 ref|XP_012832242.1| PREDICTED: uncharacterized protein LOC105953... 92 5e-20 ref|XP_022866965.1| uncharacterized protein LOC111386736 [Olea e... 91 3e-19 gb|KZV22532.1| hypothetical protein F511_09054 [Dorcoceras hygro... 82 4e-16 ref|XP_019197457.1| PREDICTED: uncharacterized protein LOC109191... 82 4e-16 gb|PIN09012.1| hypothetical protein CDL12_18405 [Handroanthus im... 82 4e-16 emb|CDP03647.1| unnamed protein product [Coffea canephora] 82 9e-16 ref|XP_006349693.1| PREDICTED: uncharacterized protein LOC102592... 79 1e-14 gb|KZV25447.1| hypothetical protein F511_17225 [Dorcoceras hygro... 77 3e-14 ref|XP_022898171.1| uncharacterized protein LOC111411801 [Olea e... 77 6e-14 ref|XP_004247177.1| PREDICTED: uncharacterized protein LOC101259... 76 1e-13 ref|XP_016471054.1| PREDICTED: uncharacterized protein LOC107793... 74 5e-13 ref|XP_015087782.1| PREDICTED: uncharacterized protein LOC107031... 73 2e-12 ref|XP_019247616.1| PREDICTED: uncharacterized protein LOC109227... 72 2e-12 ref|XP_010679066.1| PREDICTED: uncharacterized protein LOC104894... 72 4e-12 gb|OMP05087.1| hypothetical protein COLO4_09066 [Corchorus olito... 72 5e-12 gb|OMO77641.1| hypothetical protein CCACVL1_14897 [Corchorus cap... 72 5e-12 ref|XP_021281128.1| uncharacterized protein LOC110414328 [Herran... 72 5e-12 ref|XP_017626277.1| PREDICTED: uncharacterized protein LOC108469... 71 6e-12 >ref|XP_011079874.1| uncharacterized protein LOC105163283 [Sesamum indicum] Length = 205 Score = 95.9 bits (237), Expect = 2e-21 Identities = 42/57 (73%), Positives = 47/57 (82%) Frame = +3 Query: 357 METLVVVSHHRNHHQYYSRNHGYSPSKFDSFGSEPTGNFPGINCRTFQPGAGLLPTP 527 METLVVV+HHRN+H YY RN G+ SKF+SFGS P+GNF INCRTFQ G GLLPTP Sbjct: 1 METLVVVAHHRNNHHYYGRNRGHGASKFESFGSPPSGNFRAINCRTFQSGEGLLPTP 57 >gb|PIN14563.1| hypothetical protein CDL12_12797 [Handroanthus impetiginosus] Length = 90 Score = 92.0 bits (227), Expect = 4e-21 Identities = 41/59 (69%), Positives = 48/59 (81%) Frame = +3 Query: 357 METLVVVSHHRNHHQYYSRNHGYSPSKFDSFGSEPTGNFPGINCRTFQPGAGLLPTPLK 533 METLVV +HHRNHHQYY R+ + P+KFDS GS P+ NF GINCRTF+ G GLLPTPL+ Sbjct: 1 METLVV-THHRNHHQYYGRSRSHGPTKFDSIGSTPSENFAGINCRTFESGGGLLPTPLE 58 >ref|XP_012832242.1| PREDICTED: uncharacterized protein LOC105953151 [Erythranthe guttata] gb|EYU46564.1| hypothetical protein MIMGU_mgv1a013988mg [Erythranthe guttata] gb|EYU46565.1| hypothetical protein MIMGU_mgv1a013988mg [Erythranthe guttata] Length = 204 Score = 92.4 bits (228), Expect = 5e-20 Identities = 42/59 (71%), Positives = 46/59 (77%) Frame = +3 Query: 357 METLVVVSHHRNHHQYYSRNHGYSPSKFDSFGSEPTGNFPGINCRTFQPGAGLLPTPLK 533 METLVVVSHHRNHHQYY R+ S +K SFGS P+G F GINCRTF+ G GLLPTP K Sbjct: 1 METLVVVSHHRNHHQYYGRSRSRSYAKLRSFGSPPSGGFRGINCRTFESGEGLLPTPFK 59 >ref|XP_022866965.1| uncharacterized protein LOC111386736 [Olea europaea var. sylvestris] Length = 220 Score = 90.9 bits (224), Expect = 3e-19 Identities = 41/60 (68%), Positives = 45/60 (75%) Frame = +3 Query: 348 LIEMETLVVVSHHRNHHQYYSRNHGYSPSKFDSFGSEPTGNFPGINCRTFQPGAGLLPTP 527 L EMETLV V+HHRNHHQYY RN + ++F SFGS PT N GINCR FQ GAGLLP P Sbjct: 9 LKEMETLVAVAHHRNHHQYYDRNREHGSARFGSFGSPPTDNSRGINCRAFQSGAGLLPNP 68 >gb|KZV22532.1| hypothetical protein F511_09054 [Dorcoceras hygrometricum] Length = 209 Score = 82.4 bits (202), Expect = 4e-16 Identities = 38/59 (64%), Positives = 44/59 (74%) Frame = +3 Query: 357 METLVVVSHHRNHHQYYSRNHGYSPSKFDSFGSEPTGNFPGINCRTFQPGAGLLPTPLK 533 MET+VVV+ H+NHHQ YSRN SK SF S P G+F G+NCRTFQPG+GL TPLK Sbjct: 1 METVVVVAPHKNHHQSYSRNRANGSSKGGSFRSAPGGHFRGVNCRTFQPGSGLFTTPLK 59 >ref|XP_019197457.1| PREDICTED: uncharacterized protein LOC109191311 [Ipomoea nil] Length = 213 Score = 82.4 bits (202), Expect = 4e-16 Identities = 38/59 (64%), Positives = 48/59 (81%) Frame = +3 Query: 357 METLVVVSHHRNHHQYYSRNHGYSPSKFDSFGSEPTGNFPGINCRTFQPGAGLLPTPLK 533 METLVVV+ HRN QYY+++ G+ P +F SFGS P+G+F INCRTFQ G+G+LPTPLK Sbjct: 1 METLVVVAQHRN--QYYNKSKGHGPVRFGSFGSPPSGSFREINCRTFQTGSGILPTPLK 57 >gb|PIN09012.1| hypothetical protein CDL12_18405 [Handroanthus impetiginosus] Length = 201 Score = 82.0 bits (201), Expect = 4e-16 Identities = 40/59 (67%), Positives = 41/59 (69%) Frame = +3 Query: 357 METLVVVSHHRNHHQYYSRNHGYSPSKFDSFGSEPTGNFPGINCRTFQPGAGLLPTPLK 533 METLV V+ HRN HQYY RN KF GS P GNF GINCRTFQ G GLLPTPLK Sbjct: 1 METLVAVAQHRNQHQYYGRNRDQGSMKF---GSPPLGNFRGINCRTFQSGKGLLPTPLK 56 >emb|CDP03647.1| unnamed protein product [Coffea canephora] Length = 220 Score = 81.6 bits (200), Expect = 9e-16 Identities = 39/59 (66%), Positives = 46/59 (77%) Frame = +3 Query: 357 METLVVVSHHRNHHQYYSRNHGYSPSKFDSFGSEPTGNFPGINCRTFQPGAGLLPTPLK 533 METLVVV+ HRN QYYSR+ G+ P F SF S P+ +F GINCRTFQ G+GLLPTP+K Sbjct: 1 METLVVVAQHRN--QYYSRSKGHGPEPFGSFDSPPSKDFRGINCRTFQSGSGLLPTPIK 57 >ref|XP_006349693.1| PREDICTED: uncharacterized protein LOC102592129 [Solanum tuberosum] Length = 270 Score = 79.3 bits (194), Expect = 1e-14 Identities = 37/61 (60%), Positives = 44/61 (72%) Frame = +3 Query: 351 IEMETLVVVSHHRNHHQYYSRNHGYSPSKFDSFGSEPTGNFPGINCRTFQPGAGLLPTPL 530 +EMETLVVVS H+NH YY R G +P +F SFGS P+ F INCR F+ G G+LPTPL Sbjct: 53 LEMETLVVVSQHKNH--YYDRTRGQAPIRFGSFGSPPSVGFKEINCRNFESGVGILPTPL 110 Query: 531 K 533 K Sbjct: 111 K 111 >gb|KZV25447.1| hypothetical protein F511_17225 [Dorcoceras hygrometricum] Length = 209 Score = 77.4 bits (189), Expect = 3e-14 Identities = 36/59 (61%), Positives = 39/59 (66%) Frame = +3 Query: 357 METLVVVSHHRNHHQYYSRNHGYSPSKFDSFGSEPTGNFPGINCRTFQPGAGLLPTPLK 533 M+TLVVV HHRNH QYY RN G+S K +F G F GINCRT G GLLPTP K Sbjct: 1 MKTLVVVPHHRNHQQYYDRNPGHSAKKLGAFEDVAAGQFQGINCRTSHCGEGLLPTPTK 59 >ref|XP_022898171.1| uncharacterized protein LOC111411801 [Olea europaea var. sylvestris] Length = 207 Score = 76.6 bits (187), Expect = 6e-14 Identities = 37/56 (66%), Positives = 42/56 (75%), Gaps = 1/56 (1%) Frame = +3 Query: 357 METLVVVSHHRNHHQYYSRNHGYSPSKFDSFGSEPTGN-FPGINCRTFQPGAGLLP 521 METLV V+HHRNHHQYY RN G P++ FGS P+GN G+NCR FQ GAGLLP Sbjct: 1 METLVAVAHHRNHHQYYGRNCGQGPAR---FGSLPSGNSHGGVNCRAFQSGAGLLP 53 >ref|XP_004247177.1| PREDICTED: uncharacterized protein LOC101259575 [Solanum lycopersicum] Length = 216 Score = 75.9 bits (185), Expect = 1e-13 Identities = 36/59 (61%), Positives = 42/59 (71%) Frame = +3 Query: 357 METLVVVSHHRNHHQYYSRNHGYSPSKFDSFGSEPTGNFPGINCRTFQPGAGLLPTPLK 533 METLVVVS H+NH YY R G +P +F SFGS P+ F INCR F+ AG+LPTPLK Sbjct: 1 METLVVVSQHKNH--YYDRTRGQAPIRFGSFGSPPSVGFKEINCRNFESSAGILPTPLK 57 >ref|XP_016471054.1| PREDICTED: uncharacterized protein LOC107793248 [Nicotiana tabacum] Length = 180 Score = 73.6 bits (179), Expect = 5e-13 Identities = 35/59 (59%), Positives = 42/59 (71%) Frame = +3 Query: 357 METLVVVSHHRNHHQYYSRNHGYSPSKFDSFGSEPTGNFPGINCRTFQPGAGLLPTPLK 533 METLV+VS H+N QYY R G S ++F FGS P+ F INCRTF GAG+LPTPL+ Sbjct: 1 METLVIVSQHKN--QYYDRTRGQSHARFGHFGSPPSVGFKEINCRTFDSGAGILPTPLR 57 >ref|XP_015087782.1| PREDICTED: uncharacterized protein LOC107031089 [Solanum pennellii] Length = 216 Score = 72.8 bits (177), Expect = 2e-12 Identities = 35/59 (59%), Positives = 41/59 (69%) Frame = +3 Query: 357 METLVVVSHHRNHHQYYSRNHGYSPSKFDSFGSEPTGNFPGINCRTFQPGAGLLPTPLK 533 METLVVVS H+NH YY R G +P + SFGS P+ F INCR F+ AG+LPTPLK Sbjct: 1 METLVVVSQHKNH--YYDRTRGQAPIRCGSFGSPPSVGFKEINCRNFESSAGILPTPLK 57 >ref|XP_019247616.1| PREDICTED: uncharacterized protein LOC109227068 [Nicotiana attenuata] gb|OIT08135.1| hypothetical protein A4A49_32719 [Nicotiana attenuata] Length = 180 Score = 72.0 bits (175), Expect = 2e-12 Identities = 34/59 (57%), Positives = 42/59 (71%) Frame = +3 Query: 357 METLVVVSHHRNHHQYYSRNHGYSPSKFDSFGSEPTGNFPGINCRTFQPGAGLLPTPLK 533 METLV+V+ H+N QYY R G S ++F FGS P+ F INCRTF GAG+LPTPL+ Sbjct: 1 METLVIVAQHKN--QYYDRTRGQSHARFRHFGSPPSVGFKEINCRTFDSGAGILPTPLR 57 >ref|XP_010679066.1| PREDICTED: uncharacterized protein LOC104894511 [Beta vulgaris subsp. vulgaris] gb|KMT10183.1| hypothetical protein BVRB_5g119440 [Beta vulgaris subsp. vulgaris] Length = 207 Score = 71.6 bits (174), Expect = 4e-12 Identities = 39/60 (65%), Positives = 43/60 (71%), Gaps = 1/60 (1%) Frame = +3 Query: 357 METLVVVSHHRNHHQYYS-RNHGYSPSKFDSFGSEPTGNFPGINCRTFQPGAGLLPTPLK 533 METLVVV+HHRN QYYS R G SP +F GS PTG F INCRTF+ G GLLP+P K Sbjct: 1 METLVVVAHHRN--QYYSGRGKGNSPMRF---GSSPTGGFRDINCRTFESGMGLLPSPCK 55 >gb|OMP05087.1| hypothetical protein COLO4_09066 [Corchorus olitorius] Length = 211 Score = 71.6 bits (174), Expect = 5e-12 Identities = 38/59 (64%), Positives = 43/59 (72%) Frame = +3 Query: 357 METLVVVSHHRNHHQYYSRNHGYSPSKFDSFGSEPTGNFPGINCRTFQPGAGLLPTPLK 533 METLVVV+ HRN QY SR + P++F GS P+ NF GINCRTFQ GAGLLPTP K Sbjct: 1 METLVVVAQHRN--QYCSRVKPHGPARF---GSSPSRNFRGINCRTFQSGAGLLPTPFK 54 >gb|OMO77641.1| hypothetical protein CCACVL1_14897 [Corchorus capsularis] Length = 211 Score = 71.6 bits (174), Expect = 5e-12 Identities = 38/59 (64%), Positives = 43/59 (72%) Frame = +3 Query: 357 METLVVVSHHRNHHQYYSRNHGYSPSKFDSFGSEPTGNFPGINCRTFQPGAGLLPTPLK 533 METLVVV+ HRN QY SR + P++F GS P+ NF GINCRTFQ GAGLLPTP K Sbjct: 1 METLVVVAQHRN--QYCSRVKPHGPARF---GSSPSRNFRGINCRTFQSGAGLLPTPFK 54 >ref|XP_021281128.1| uncharacterized protein LOC110414328 [Herrania umbratica] Length = 214 Score = 71.6 bits (174), Expect = 5e-12 Identities = 38/59 (64%), Positives = 43/59 (72%) Frame = +3 Query: 357 METLVVVSHHRNHHQYYSRNHGYSPSKFDSFGSEPTGNFPGINCRTFQPGAGLLPTPLK 533 METLVVV+ HRN QY SR + P++F GS P+ NF GINCRTFQ GAGLLPTP K Sbjct: 1 METLVVVAQHRN--QYCSRVKPHGPARF---GSSPSRNFRGINCRTFQSGAGLLPTPFK 54 >ref|XP_017626277.1| PREDICTED: uncharacterized protein LOC108469766 [Gossypium arboreum] gb|PPS00363.1| hypothetical protein GOBAR_AA20295 [Gossypium barbadense] Length = 209 Score = 71.2 bits (173), Expect = 6e-12 Identities = 37/59 (62%), Positives = 44/59 (74%) Frame = +3 Query: 357 METLVVVSHHRNHHQYYSRNHGYSPSKFDSFGSEPTGNFPGINCRTFQPGAGLLPTPLK 533 METLVVV+ HRN QY SR + P++F S S+P+ NF G+NCRTFQ GAGLLPTP K Sbjct: 1 METLVVVAQHRN--QYCSRVKPHGPARFGS--SQPSRNFRGVNCRTFQSGAGLLPTPFK 55