BLASTX nr result
ID: Rehmannia32_contig00014436
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00014436 (350 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN06591.1| hypothetical protein CDL12_20856 [Handroanthus im... 62 1e-09 ref|XP_011075286.1| FAD synthetase 1, chloroplastic [Sesamum ind... 62 7e-09 ref|XP_012834993.1| PREDICTED: FAD synthetase 1, chloroplastic-l... 60 6e-08 >gb|PIN06591.1| hypothetical protein CDL12_20856 [Handroanthus impetiginosus] Length = 140 Score = 62.0 bits (149), Expect = 1e-09 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -3 Query: 123 MMMSGCRISQQLREYNPRQFGICSFNGNKQSSF 25 MMM+GCRISQQLREYNPRQ GICSFNG K F Sbjct: 1 MMMTGCRISQQLREYNPRQLGICSFNGRKHGCF 33 >ref|XP_011075286.1| FAD synthetase 1, chloroplastic [Sesamum indicum] Length = 405 Score = 62.4 bits (150), Expect = 7e-09 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = -3 Query: 123 MMMSGCRISQQLREYNPRQFGICSFNGNKQSSFYFTKAP 7 MM+SG RISQQLREYNP Q GICSFNGNK Y+ KAP Sbjct: 1 MMISGHRISQQLREYNPCQLGICSFNGNKHCWLYYDKAP 39 >ref|XP_012834993.1| PREDICTED: FAD synthetase 1, chloroplastic-like [Erythranthe guttata] gb|EYU39408.1| hypothetical protein MIMGU_mgv1a007485mg [Erythranthe guttata] Length = 406 Score = 59.7 bits (143), Expect = 6e-08 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = -3 Query: 123 MMMSGCRISQQLREYNPRQFGICSFNGNKQSSFYFTK 13 M M+GCRISQQLREYNPRQFGICS N + FY+ + Sbjct: 1 MTMNGCRISQQLREYNPRQFGICSLTNNTKCCFYYNR 37