BLASTX nr result
ID: Rehmannia32_contig00014367
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00014367 (422 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN14278.1| Small monomeric GTPase [Handroanthus impetiginosus] 58 7e-07 ref|XP_012833740.1| PREDICTED: translocase of chloroplast 120, c... 57 2e-06 >gb|PIN14278.1| Small monomeric GTPase [Handroanthus impetiginosus] Length = 1345 Score = 57.8 bits (138), Expect = 7e-07 Identities = 33/56 (58%), Positives = 36/56 (64%) Frame = -2 Query: 169 MENGIGIAEDAKLRESNAVNSEVLEPSIKEXXXXXXXXXXXXXXDEVFEEAVEAET 2 ME G GIA+DAKL E AV+SEVL+PSI E DEVFEEAVEAET Sbjct: 1 MEKGTGIADDAKLEERKAVDSEVLDPSIDESVDSNLGGSKNLDTDEVFEEAVEAET 56 >ref|XP_012833740.1| PREDICTED: translocase of chloroplast 120, chloroplastic-like [Erythranthe guttata] Length = 1552 Score = 56.6 bits (135), Expect = 2e-06 Identities = 32/56 (57%), Positives = 37/56 (66%) Frame = -2 Query: 169 MENGIGIAEDAKLRESNAVNSEVLEPSIKEXXXXXXXXXXXXXXDEVFEEAVEAET 2 MENGIGIAEDAKLRE + V S+V+EP + + DEVFEEAVEAET Sbjct: 1 MENGIGIAEDAKLREMSVVASKVVEPIMNKTVDLGSDESQCSDGDEVFEEAVEAET 56