BLASTX nr result
ID: Rehmannia32_contig00014198
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00014198 (404 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012836112.1| PREDICTED: iron-sulfur assembly protein IscA... 124 2e-33 ref|XP_016559866.1| PREDICTED: iron-sulfur assembly protein IscA... 121 2e-32 gb|PHT98690.1| Iron-sulfur assembly protein IscA-like 2, mitocho... 121 2e-32 gb|PHT61558.1| Iron-sulfur assembly protein IscA-like 2, mitocho... 121 2e-32 gb|PHT55959.1| Iron-sulfur assembly protein IscA-like 2, mitocho... 121 2e-32 gb|PHT28296.1| Iron-sulfur assembly protein IscA-like 2, mitocho... 121 2e-32 ref|XP_016538774.1| PREDICTED: iron-sulfur assembly protein IscA... 121 2e-32 ref|XP_009804604.1| PREDICTED: iron-sulfur assembly protein IscA... 120 4e-32 ref|XP_009617972.1| PREDICTED: iron-sulfur assembly protein IscA... 120 4e-32 ref|XP_009789312.1| PREDICTED: iron-sulfur assembly protein IscA... 120 4e-32 ref|XP_019241161.1| PREDICTED: iron-sulfur assembly protein IscA... 120 4e-32 ref|XP_019239774.1| PREDICTED: iron-sulfur assembly protein IscA... 120 6e-32 ref|XP_015085142.1| PREDICTED: iron-sulfur assembly protein IscA... 120 6e-32 ref|XP_006344753.1| PREDICTED: iron-sulfur assembly protein IscA... 119 9e-32 ref|XP_004230302.1| PREDICTED: iron-sulfur assembly protein IscA... 119 9e-32 ref|XP_020549460.1| iron-sulfur assembly protein IscA-like 2, mi... 119 1e-31 ref|XP_019186364.1| PREDICTED: iron-sulfur assembly protein IscA... 117 7e-31 ref|XP_021908829.1| iron-sulfur assembly protein IscA-like 2, mi... 117 8e-31 ref|XP_022842722.1| iron-sulfur assembly protein IscA-like 2, mi... 116 1e-30 ref|XP_020524649.1| iron-sulfur assembly protein IscA-like 2, mi... 114 2e-30 >ref|XP_012836112.1| PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Erythranthe guttata] gb|EYU38634.1| hypothetical protein MIMGU_mgv1a015468mg [Erythranthe guttata] Length = 157 Score = 124 bits (310), Expect = 2e-33 Identities = 60/62 (96%), Positives = 61/62 (98%) Frame = -3 Query: 402 KTNNDDRIFEKDGVKLVVDNISLDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF 223 KTNNDDRIFEKDGVKLVVDNIS DFVKGAT+DYVEELIRSAFQVSTNPSAVGGCSCKSSF Sbjct: 95 KTNNDDRIFEKDGVKLVVDNISFDFVKGATIDYVEELIRSAFQVSTNPSAVGGCSCKSSF 154 Query: 222 MV 217 MV Sbjct: 155 MV 156 >ref|XP_016559866.1| PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Capsicum annuum] gb|PHT96920.1| Iron-sulfur cluster assembly 2 -like protein, mitochondrial [Capsicum chinense] Length = 158 Score = 121 bits (303), Expect = 2e-32 Identities = 59/62 (95%), Positives = 61/62 (98%) Frame = -3 Query: 402 KTNNDDRIFEKDGVKLVVDNISLDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF 223 KTN+DDRIFE+DGVKLVVDNIS DFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF Sbjct: 95 KTNSDDRIFERDGVKLVVDNISFDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF 154 Query: 222 MV 217 MV Sbjct: 155 MV 156 >gb|PHT98690.1| Iron-sulfur assembly protein IscA-like 2, mitochondrial [Capsicum chinense] Length = 160 Score = 121 bits (303), Expect = 2e-32 Identities = 59/62 (95%), Positives = 61/62 (98%) Frame = -3 Query: 402 KTNNDDRIFEKDGVKLVVDNISLDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF 223 KTN+DDRIFE+DGVKLVVDNIS DFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF Sbjct: 97 KTNSDDRIFERDGVKLVVDNISFDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF 156 Query: 222 MV 217 MV Sbjct: 157 MV 158 >gb|PHT61558.1| Iron-sulfur assembly protein IscA-like 2, mitochondrial [Capsicum annuum] Length = 160 Score = 121 bits (303), Expect = 2e-32 Identities = 59/62 (95%), Positives = 61/62 (98%) Frame = -3 Query: 402 KTNNDDRIFEKDGVKLVVDNISLDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF 223 KTN+DDRIFE+DGVKLVVDNIS DFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF Sbjct: 97 KTNSDDRIFERDGVKLVVDNISFDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF 156 Query: 222 MV 217 MV Sbjct: 157 MV 158 >gb|PHT55959.1| Iron-sulfur assembly protein IscA-like 2, mitochondrial [Capsicum baccatum] Length = 160 Score = 121 bits (303), Expect = 2e-32 Identities = 59/62 (95%), Positives = 61/62 (98%) Frame = -3 Query: 402 KTNNDDRIFEKDGVKLVVDNISLDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF 223 KTN+DDRIFE+DGVKLVVDNIS DFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF Sbjct: 97 KTNSDDRIFERDGVKLVVDNISFDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF 156 Query: 222 MV 217 MV Sbjct: 157 MV 158 >gb|PHT28296.1| Iron-sulfur assembly protein IscA-like 2, mitochondrial [Capsicum baccatum] Length = 160 Score = 121 bits (303), Expect = 2e-32 Identities = 59/62 (95%), Positives = 61/62 (98%) Frame = -3 Query: 402 KTNNDDRIFEKDGVKLVVDNISLDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF 223 KTN+DDRIFE+DGVKLVVDNIS DFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF Sbjct: 97 KTNSDDRIFERDGVKLVVDNISFDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF 156 Query: 222 MV 217 MV Sbjct: 157 MV 158 >ref|XP_016538774.1| PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Capsicum annuum] Length = 160 Score = 121 bits (303), Expect = 2e-32 Identities = 59/62 (95%), Positives = 61/62 (98%) Frame = -3 Query: 402 KTNNDDRIFEKDGVKLVVDNISLDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF 223 KTN+DDRIFE+DGVKLVVDNIS DFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF Sbjct: 97 KTNSDDRIFERDGVKLVVDNISFDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF 156 Query: 222 MV 217 MV Sbjct: 157 MV 158 >ref|XP_009804604.1| PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Nicotiana sylvestris] ref|XP_016503625.1| PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Nicotiana tabacum] Length = 153 Score = 120 bits (301), Expect = 4e-32 Identities = 58/62 (93%), Positives = 61/62 (98%) Frame = -3 Query: 402 KTNNDDRIFEKDGVKLVVDNISLDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF 223 KTN+DDRIFE+DGVKLVVDN+S DFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF Sbjct: 90 KTNSDDRIFERDGVKLVVDNVSYDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF 149 Query: 222 MV 217 MV Sbjct: 150 MV 151 >ref|XP_009617972.1| PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial isoform X1 [Nicotiana tomentosiformis] ref|XP_016492065.1| PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Nicotiana tabacum] ref|XP_018631140.1| PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial isoform X1 [Nicotiana tomentosiformis] Length = 157 Score = 120 bits (301), Expect = 4e-32 Identities = 58/62 (93%), Positives = 61/62 (98%) Frame = -3 Query: 402 KTNNDDRIFEKDGVKLVVDNISLDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF 223 KTN+DDRIFE+DGVKLVVDN+S DFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF Sbjct: 94 KTNSDDRIFERDGVKLVVDNVSYDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF 153 Query: 222 MV 217 MV Sbjct: 154 MV 155 >ref|XP_009789312.1| PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Nicotiana sylvestris] ref|XP_016457278.1| PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Nicotiana tabacum] Length = 158 Score = 120 bits (301), Expect = 4e-32 Identities = 58/62 (93%), Positives = 61/62 (98%) Frame = -3 Query: 402 KTNNDDRIFEKDGVKLVVDNISLDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF 223 KTN+DDRIFE+DGVKLVVDN+S DFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF Sbjct: 95 KTNSDDRIFERDGVKLVVDNVSYDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF 154 Query: 222 MV 217 MV Sbjct: 155 MV 156 >ref|XP_019241161.1| PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Nicotiana attenuata] ref|XP_019242787.1| PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Nicotiana attenuata] gb|OIT07612.1| iron-sulfur assembly protein isca-like 2, mitochondrial [Nicotiana attenuata] gb|OIT19682.1| iron-sulfur assembly protein isca-like 2, mitochondrial [Nicotiana attenuata] Length = 161 Score = 120 bits (301), Expect = 4e-32 Identities = 58/62 (93%), Positives = 61/62 (98%) Frame = -3 Query: 402 KTNNDDRIFEKDGVKLVVDNISLDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF 223 KTN+DDRIFE+DGVKLVVDN+S DFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF Sbjct: 98 KTNSDDRIFERDGVKLVVDNVSYDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF 157 Query: 222 MV 217 MV Sbjct: 158 MV 159 >ref|XP_019239774.1| PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Nicotiana attenuata] gb|OIT20767.1| iron-sulfur assembly protein isca-like 2, mitochondrial [Nicotiana attenuata] Length = 158 Score = 120 bits (300), Expect = 6e-32 Identities = 57/62 (91%), Positives = 61/62 (98%) Frame = -3 Query: 402 KTNNDDRIFEKDGVKLVVDNISLDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF 223 KTN+DDRIFE+DGVKLVVDN+S DF+KGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF Sbjct: 95 KTNSDDRIFERDGVKLVVDNVSYDFIKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF 154 Query: 222 MV 217 MV Sbjct: 155 MV 156 >ref|XP_015085142.1| PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Solanum pennellii] Length = 160 Score = 120 bits (300), Expect = 6e-32 Identities = 58/62 (93%), Positives = 60/62 (96%) Frame = -3 Query: 402 KTNNDDRIFEKDGVKLVVDNISLDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF 223 KTN+DDRIFE DGVKLVVDN+S DFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF Sbjct: 97 KTNSDDRIFENDGVKLVVDNVSFDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF 156 Query: 222 MV 217 MV Sbjct: 157 MV 158 >ref|XP_006344753.1| PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Solanum tuberosum] Length = 160 Score = 119 bits (299), Expect = 9e-32 Identities = 58/62 (93%), Positives = 60/62 (96%) Frame = -3 Query: 402 KTNNDDRIFEKDGVKLVVDNISLDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF 223 KTN+DDRIFE DGVKLVVDN+S DFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF Sbjct: 97 KTNSDDRIFEHDGVKLVVDNVSFDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF 156 Query: 222 MV 217 MV Sbjct: 157 MV 158 >ref|XP_004230302.1| PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Solanum lycopersicum] Length = 160 Score = 119 bits (299), Expect = 9e-32 Identities = 58/62 (93%), Positives = 60/62 (96%) Frame = -3 Query: 402 KTNNDDRIFEKDGVKLVVDNISLDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF 223 KTN+DDRIFE DGVKLVVDN+S DFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF Sbjct: 97 KTNSDDRIFEHDGVKLVVDNVSFDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF 156 Query: 222 MV 217 MV Sbjct: 157 MV 158 >ref|XP_020549460.1| iron-sulfur assembly protein IscA-like 2, mitochondrial isoform X4 [Sesamum indicum] ref|XP_020549461.1| iron-sulfur assembly protein IscA-like 2, mitochondrial isoform X4 [Sesamum indicum] Length = 166 Score = 119 bits (299), Expect = 1e-31 Identities = 58/62 (93%), Positives = 61/62 (98%) Frame = -3 Query: 402 KTNNDDRIFEKDGVKLVVDNISLDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF 223 KTN+DDRIFE+DGV+LVVDNIS DFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF Sbjct: 104 KTNDDDRIFEQDGVRLVVDNISFDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF 163 Query: 222 MV 217 MV Sbjct: 164 MV 165 >ref|XP_019186364.1| PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Ipomoea nil] Length = 160 Score = 117 bits (293), Expect = 7e-31 Identities = 58/62 (93%), Positives = 59/62 (95%) Frame = -3 Query: 402 KTNNDDRIFEKDGVKLVVDNISLDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF 223 K N DDRIFE+DGVKLVVDNIS DFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF Sbjct: 97 KANVDDRIFEQDGVKLVVDNISFDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF 156 Query: 222 MV 217 MV Sbjct: 157 MV 158 >ref|XP_021908829.1| iron-sulfur assembly protein IscA-like 2, mitochondrial [Carica papaya] Length = 165 Score = 117 bits (293), Expect = 8e-31 Identities = 56/62 (90%), Positives = 60/62 (96%) Frame = -3 Query: 402 KTNNDDRIFEKDGVKLVVDNISLDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF 223 KTN+DDRIFEKDGVKLVVDN+S DFVKGAT+DYVEELIRSAF V+TNPSAVGGCSCKSSF Sbjct: 102 KTNSDDRIFEKDGVKLVVDNVSYDFVKGATIDYVEELIRSAFVVTTNPSAVGGCSCKSSF 161 Query: 222 MV 217 MV Sbjct: 162 MV 163 >ref|XP_022842722.1| iron-sulfur assembly protein IscA-like 2, mitochondrial [Olea europaea var. sylvestris] Length = 162 Score = 116 bits (291), Expect = 1e-30 Identities = 56/62 (90%), Positives = 59/62 (95%) Frame = -3 Query: 402 KTNNDDRIFEKDGVKLVVDNISLDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSF 223 K N+DDRIFE+DGVKLVVDNIS DFVKGAT+DYVEELIRSAFQVS NPSAVGGCSCKSSF Sbjct: 99 KANDDDRIFERDGVKLVVDNISYDFVKGATIDYVEELIRSAFQVSANPSAVGGCSCKSSF 158 Query: 222 MV 217 MV Sbjct: 159 MV 160 >ref|XP_020524649.1| iron-sulfur assembly protein IscA-like 2, mitochondrial isoform X2 [Amborella trichopoda] Length = 99 Score = 114 bits (285), Expect = 2e-30 Identities = 55/60 (91%), Positives = 58/60 (96%) Frame = -3 Query: 396 NNDDRIFEKDGVKLVVDNISLDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSFMV 217 N DDR+FEKDGVKLVVDNIS DFVKG+TVDYVEELIRSAFQV+TNPSAVGGCSCKSSFMV Sbjct: 39 NPDDRVFEKDGVKLVVDNISYDFVKGSTVDYVEELIRSAFQVTTNPSAVGGCSCKSSFMV 98