BLASTX nr result
ID: Rehmannia32_contig00012326
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00012326 (429 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN26243.1| Molecular chaperone (DnaJ superfamily) [Handroant... 87 2e-19 ref|XP_011092835.1| mitochondrial import inner membrane transloc... 86 6e-19 ref|XP_012830994.1| PREDICTED: mitochondrial import inner membra... 85 1e-18 ref|XP_009604556.1| PREDICTED: mitochondrial import inner membra... 83 6e-18 ref|XP_022856408.1| mitochondrial import inner membrane transloc... 83 7e-18 gb|KZV48169.1| hypothetical protein F511_25958 [Dorcoceras hygro... 84 8e-18 ref|XP_019247328.1| PREDICTED: mitochondrial import inner membra... 82 1e-17 ref|XP_019265530.1| PREDICTED: mitochondrial import inner membra... 82 2e-17 ref|XP_019162613.1| PREDICTED: mitochondrial import inner membra... 82 2e-17 ref|XP_022966723.1| mitochondrial import inner membrane transloc... 82 3e-17 ref|XP_009130726.1| PREDICTED: mitochondrial import inner membra... 82 3e-17 ref|XP_020578133.1| mitochondrial import inner membrane transloc... 80 3e-17 emb|CDY11237.1| BnaA03g00730D [Brassica napus] 82 3e-17 ref|XP_009797013.1| PREDICTED: mitochondrial import inner membra... 81 4e-17 gb|EPS66738.1| hypothetical protein M569_08041, partial [Genlise... 81 4e-17 ref|XP_004304402.1| PREDICTED: mitochondrial import inner membra... 81 4e-17 gb|OIT35653.1| mitochondrial import inner membrane translocase s... 82 4e-17 ref|XP_022009643.1| mitochondrial import inner membrane transloc... 81 4e-17 ref|XP_021601627.1| mitochondrial import inner membrane transloc... 81 4e-17 ref|XP_008446910.1| PREDICTED: mitochondrial import inner membra... 81 4e-17 >gb|PIN26243.1| Molecular chaperone (DnaJ superfamily) [Handroanthus impetiginosus] Length = 112 Score = 87.0 bits (214), Expect = 2e-19 Identities = 41/45 (91%), Positives = 45/45 (100%) Frame = -2 Query: 407 RLREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 273 ++REAHRRVMVANHPDAGGSHY+ASKINEAK+VLLGKSKSSDSAF Sbjct: 68 KVREAHRRVMVANHPDAGGSHYLASKINEAKDVLLGKSKSSDSAF 112 >ref|XP_011092835.1| mitochondrial import inner membrane translocase subunit TIM14-1 [Sesamum indicum] Length = 112 Score = 85.9 bits (211), Expect = 6e-19 Identities = 40/45 (88%), Positives = 45/45 (100%) Frame = -2 Query: 407 RLREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 273 ++REAHRRVMVANHPDAGGSHY+ASKINEAK+VLLGK+KSSDSAF Sbjct: 68 KVREAHRRVMVANHPDAGGSHYLASKINEAKDVLLGKTKSSDSAF 112 >ref|XP_012830994.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1-like [Erythranthe guttata] gb|EYU42589.1| hypothetical protein MIMGU_mgv1a016665mg [Erythranthe guttata] Length = 112 Score = 85.1 bits (209), Expect = 1e-18 Identities = 38/45 (84%), Positives = 45/45 (100%) Frame = -2 Query: 407 RLREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 273 ++REAHRRVMVANHPDAGGSHY+ASKINEAK++++GKSKSSDSAF Sbjct: 68 KVREAHRRVMVANHPDAGGSHYLASKINEAKDIMMGKSKSSDSAF 112 >ref|XP_009604556.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-3-like [Nicotiana tomentosiformis] ref|XP_016468229.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-3-like [Nicotiana tabacum] Length = 109 Score = 83.2 bits (204), Expect = 6e-18 Identities = 38/47 (80%), Positives = 46/47 (97%) Frame = -2 Query: 413 LIRLREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 273 L +++EAHRRVMVANHPDAGGSHY+ASKINEAKEVLLGK+K+++SAF Sbjct: 63 LEKIKEAHRRVMVANHPDAGGSHYIASKINEAKEVLLGKTKTANSAF 109 >ref|XP_022856408.1| mitochondrial import inner membrane translocase subunit TIM14-3-like [Olea europaea var. sylvestris] Length = 112 Score = 83.2 bits (204), Expect = 7e-18 Identities = 38/45 (84%), Positives = 44/45 (97%) Frame = -2 Query: 407 RLREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 273 ++REAHRRVMVANHPDAGGSHY+ASKINEAK++L+GKSKSS SAF Sbjct: 68 KVREAHRRVMVANHPDAGGSHYLASKINEAKDILMGKSKSSGSAF 112 >gb|KZV48169.1| hypothetical protein F511_25958 [Dorcoceras hygrometricum] Length = 132 Score = 83.6 bits (205), Expect = 8e-18 Identities = 37/45 (82%), Positives = 45/45 (100%) Frame = -2 Query: 407 RLREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 273 ++REAHRRVMVANHPDAGGSHY+ASKINEAK+++LGKS++SDSAF Sbjct: 88 KVREAHRRVMVANHPDAGGSHYLASKINEAKDIILGKSRNSDSAF 132 >ref|XP_019247328.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-3-like [Nicotiana attenuata] gb|OIT02098.1| mitochondrial import inner membrane translocase subunit tim14-3 [Nicotiana attenuata] Length = 109 Score = 82.4 bits (202), Expect = 1e-17 Identities = 37/47 (78%), Positives = 45/47 (95%) Frame = -2 Query: 413 LIRLREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 273 L +++EAHRRVMVANHPDAGGSHY+ASKINEAKE+LLGK+K ++SAF Sbjct: 63 LEKIKEAHRRVMVANHPDAGGSHYIASKINEAKEILLGKTKGANSAF 109 >ref|XP_019265530.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1-like [Nicotiana attenuata] Length = 110 Score = 82.0 bits (201), Expect = 2e-17 Identities = 37/45 (82%), Positives = 44/45 (97%) Frame = -2 Query: 407 RLREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 273 ++REAHRRVM+ANHPDAGGSHY+ASKINEAK+V+LGK+KSS SAF Sbjct: 66 KVREAHRRVMIANHPDAGGSHYLASKINEAKDVMLGKTKSSGSAF 110 >ref|XP_019162613.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-3-like [Ipomoea nil] Length = 112 Score = 82.0 bits (201), Expect = 2e-17 Identities = 38/45 (84%), Positives = 44/45 (97%) Frame = -2 Query: 407 RLREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 273 +++EAHRRVMVANHPDAGGSHY+ASKINEAK+VLLGK+KSS SAF Sbjct: 68 KVKEAHRRVMVANHPDAGGSHYLASKINEAKDVLLGKTKSSGSAF 112 >ref|XP_022966723.1| mitochondrial import inner membrane translocase subunit TIM14-1-like isoform X2 [Cucurbita maxima] ref|XP_023541262.1| mitochondrial import inner membrane translocase subunit TIM14-1-like [Cucurbita pepo subsp. pepo] ref|XP_023541263.1| mitochondrial import inner membrane translocase subunit TIM14-1-like [Cucurbita pepo subsp. pepo] Length = 112 Score = 81.6 bits (200), Expect = 3e-17 Identities = 37/45 (82%), Positives = 43/45 (95%) Frame = -2 Query: 407 RLREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 273 +++EAHRRVM+ANHPDAGGSHY+ASKINEAK+VLLGKSK S SAF Sbjct: 68 KIKEAHRRVMIANHPDAGGSHYLASKINEAKDVLLGKSKGSPSAF 112 >ref|XP_009130726.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-3-like [Brassica rapa] ref|XP_013740084.1| mitochondrial import inner membrane translocase subunit TIM14-3-like [Brassica napus] Length = 112 Score = 81.6 bits (200), Expect = 3e-17 Identities = 36/45 (80%), Positives = 44/45 (97%) Frame = -2 Query: 407 RLREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 273 +++EAHRRVMVANHPDAGGSHY+ASKINEAK+++LGKS +SDSAF Sbjct: 68 KVKEAHRRVMVANHPDAGGSHYLASKINEAKDIMLGKSNNSDSAF 112 >ref|XP_020578133.1| mitochondrial import inner membrane translocase subunit TIM14-3-like isoform X2 [Phalaenopsis equestris] Length = 76 Score = 80.5 bits (197), Expect = 3e-17 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = -2 Query: 407 RLREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 273 ++REAHR+VMVANHPDAGGSHY+ASKINEAK+VLLGKSK SAF Sbjct: 32 KIREAHRKVMVANHPDAGGSHYLASKINEAKDVLLGKSKGGGSAF 76 >emb|CDY11237.1| BnaA03g00730D [Brassica napus] Length = 121 Score = 81.6 bits (200), Expect = 3e-17 Identities = 36/45 (80%), Positives = 44/45 (97%) Frame = -2 Query: 407 RLREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 273 +++EAHRRVMVANHPDAGGSHY+ASKINEAK+++LGKS +SDSAF Sbjct: 77 KVKEAHRRVMVANHPDAGGSHYLASKINEAKDIMLGKSNNSDSAF 121 >ref|XP_009797013.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-3-like isoform X2 [Nicotiana sylvestris] ref|XP_016456834.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-3-like [Nicotiana tabacum] Length = 109 Score = 81.3 bits (199), Expect = 4e-17 Identities = 36/47 (76%), Positives = 45/47 (95%) Frame = -2 Query: 413 LIRLREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 273 L +++EAHRRVMVANHPDAGGSHY+ASKINEAK++LLGK+K ++SAF Sbjct: 63 LEKIKEAHRRVMVANHPDAGGSHYIASKINEAKDILLGKTKGANSAF 109 >gb|EPS66738.1| hypothetical protein M569_08041, partial [Genlisea aurea] Length = 110 Score = 81.3 bits (199), Expect = 4e-17 Identities = 35/45 (77%), Positives = 44/45 (97%) Frame = -2 Query: 407 RLREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 273 ++REAHRRVM+ANHPD GGSHY+ASKINEAK+V+LGK+K++DSAF Sbjct: 66 KIREAHRRVMIANHPDGGGSHYLASKINEAKDVMLGKTKTTDSAF 110 >ref|XP_004304402.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-2-like [Fragaria vesca subsp. vesca] Length = 110 Score = 81.3 bits (199), Expect = 4e-17 Identities = 37/51 (72%), Positives = 46/51 (90%) Frame = -2 Query: 425 KALRLIRLREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 273 +++ + ++REAHRRVMVANHPDAGGSHY+ASKINEAKE LLG++K S SAF Sbjct: 60 ESVPITKVREAHRRVMVANHPDAGGSHYLASKINEAKETLLGRTKGSSSAF 110 >gb|OIT35653.1| mitochondrial import inner membrane translocase subunit tim14-1, partial [Nicotiana attenuata] Length = 137 Score = 82.0 bits (201), Expect = 4e-17 Identities = 37/45 (82%), Positives = 44/45 (97%) Frame = -2 Query: 407 RLREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 273 ++REAHRRVM+ANHPDAGGSHY+ASKINEAK+V+LGK+KSS SAF Sbjct: 93 KVREAHRRVMIANHPDAGGSHYLASKINEAKDVMLGKTKSSGSAF 137 >ref|XP_022009643.1| mitochondrial import inner membrane translocase subunit TIM14-1 [Helianthus annuus] gb|OTF97995.1| putative chaperone DnaJ-domain superfamily protein [Helianthus annuus] Length = 112 Score = 81.3 bits (199), Expect = 4e-17 Identities = 37/45 (82%), Positives = 44/45 (97%) Frame = -2 Query: 407 RLREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 273 ++REAHRRVMVANHPDAGGSHY+ASKINEAK+V+LGK+K+S SAF Sbjct: 68 KVREAHRRVMVANHPDAGGSHYLASKINEAKDVMLGKTKNSGSAF 112 >ref|XP_021601627.1| mitochondrial import inner membrane translocase subunit TIM14-3-like [Manihot esculenta] gb|OAY56499.1| hypothetical protein MANES_02G021600 [Manihot esculenta] Length = 112 Score = 81.3 bits (199), Expect = 4e-17 Identities = 37/45 (82%), Positives = 43/45 (95%) Frame = -2 Query: 407 RLREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 273 ++REAHRRVMVANHPDAGGSHY+ASKINEAK++LLGK+K S SAF Sbjct: 68 KVREAHRRVMVANHPDAGGSHYLASKINEAKDILLGKAKGSGSAF 112 >ref|XP_008446910.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1-like [Cucumis melo] Length = 112 Score = 81.3 bits (199), Expect = 4e-17 Identities = 37/45 (82%), Positives = 43/45 (95%) Frame = -2 Query: 407 RLREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 273 +++EAHRRVM+ANHPDAGGSHY+ASKINEAK+VLLGKSKSS S F Sbjct: 68 KIKEAHRRVMIANHPDAGGSHYLASKINEAKDVLLGKSKSSGSPF 112