BLASTX nr result
ID: Rehmannia32_contig00012282
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00012282 (381 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011096938.1| protein MIS12 homolog [Sesamum indicum] 57 6e-07 ref|XP_012836582.1| PREDICTED: uncharacterized protein LOC105957... 54 8e-06 >ref|XP_011096938.1| protein MIS12 homolog [Sesamum indicum] Length = 243 Score = 56.6 bits (135), Expect = 6e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +1 Query: 1 LRVRHGDVLRMPRNNGLFGAKLEELQQFLDEI 96 LRVRHGD+L MP NG FGAKLEELQ+FLDEI Sbjct: 210 LRVRHGDLLNMPHGNGPFGAKLEELQEFLDEI 241 >ref|XP_012836582.1| PREDICTED: uncharacterized protein LOC105957204 [Erythranthe guttata] gb|EYU38163.1| hypothetical protein MIMGU_mgv1a012616mg [Erythranthe guttata] Length = 245 Score = 53.5 bits (127), Expect = 8e-06 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +1 Query: 13 HGDVLRMPRNNGLFGAKLEELQQFLDEITT 102 HGD+LRMPR++GLFGAKLEEL++FLDE+ T Sbjct: 215 HGDLLRMPRSSGLFGAKLEELEKFLDEMPT 244