BLASTX nr result
ID: Rehmannia32_contig00012055
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00012055 (449 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022887665.1| LOW QUALITY PROTEIN: 65-kDa microtubule-asso... 60 1e-07 ref|XP_011086779.1| 65-kDa microtubule-associated protein 8 isof... 60 2e-07 ref|XP_020551884.1| 65-kDa microtubule-associated protein 8 isof... 60 2e-07 gb|PIN09345.1| Microtubule-associated protein essential for anap... 60 2e-07 ref|XP_011086778.1| 65-kDa microtubule-associated protein 8 isof... 60 2e-07 ref|XP_002303801.2| hypothetical protein POPTR_0003s17180g [Popu... 58 6e-07 ref|XP_020539268.1| 65-kDa microtubule-associated protein 8 isof... 58 8e-07 ref|XP_020539267.1| 65-kDa microtubule-associated protein 8 isof... 58 8e-07 gb|KDP26794.1| hypothetical protein JCGZ_17952 [Jatropha curcas] 58 8e-07 emb|CBI27647.3| unnamed protein product, partial [Vitis vinifera] 58 8e-07 gb|EEF47478.1| PLE, putative [Ricinus communis] 58 8e-07 ref|XP_011020730.1| PREDICTED: 65-kDa microtubule-associated pro... 58 8e-07 ref|XP_021644335.1| 65-kDa microtubule-associated protein 8 isof... 58 8e-07 ref|XP_021629951.1| 65-kDa microtubule-associated protein 8 isof... 58 8e-07 ref|XP_012085669.1| 65-kDa microtubule-associated protein 8 isof... 58 8e-07 ref|XP_002271779.2| PREDICTED: 65-kDa microtubule-associated pro... 58 8e-07 ref|XP_015572131.1| PREDICTED: 65-kDa microtubule-associated pro... 58 8e-07 dbj|GAV66499.1| MAP65_ASE1 domain-containing protein [Cephalotus... 57 1e-06 ref|XP_011002137.1| PREDICTED: 65-kDa microtubule-associated pro... 57 1e-06 ref|XP_011002136.1| PREDICTED: 65-kDa microtubule-associated pro... 57 1e-06 >ref|XP_022887665.1| LOW QUALITY PROTEIN: 65-kDa microtubule-associated protein 8 [Olea europaea var. sylvestris] Length = 619 Score = 60.1 bits (144), Expect = 1e-07 Identities = 35/56 (62%), Positives = 42/56 (75%) Frame = -1 Query: 401 KIHSTLQQHEEEKWKESRHCHTANISRARLHQRLVKSKAEFTYLLLSLGERSLTGR 234 KI L+Q E ++ R TANISRARLHQ+L +S+AEFT+LLLSLGERSL GR Sbjct: 74 KILLELEQECLEVYR--RKVDTANISRARLHQQLAESEAEFTHLLLSLGERSLPGR 127 >ref|XP_011086779.1| 65-kDa microtubule-associated protein 8 isoform X3 [Sesamum indicum] Length = 527 Score = 59.7 bits (143), Expect = 2e-07 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -1 Query: 350 RHCHTANISRARLHQRLVKSKAEFTYLLLSLGERSLTGR 234 R TANISRARLHQ+L +S+AEFT+LLLSLGERSL GR Sbjct: 58 RKVDTANISRARLHQQLAESEAEFTHLLLSLGERSLPGR 96 >ref|XP_020551884.1| 65-kDa microtubule-associated protein 8 isoform X2 [Sesamum indicum] Length = 593 Score = 59.7 bits (143), Expect = 2e-07 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -1 Query: 350 RHCHTANISRARLHQRLVKSKAEFTYLLLSLGERSLTGR 234 R TANISRARLHQ+L +S+AEFT+LLLSLGERSL GR Sbjct: 58 RKVDTANISRARLHQQLAESEAEFTHLLLSLGERSLPGR 96 >gb|PIN09345.1| Microtubule-associated protein essential for anaphase spindle elongation [Handroanthus impetiginosus] Length = 595 Score = 59.7 bits (143), Expect = 2e-07 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -1 Query: 350 RHCHTANISRARLHQRLVKSKAEFTYLLLSLGERSLTGR 234 R TANISRARLHQ+L +S+AEFT+LLLSLGERSL GR Sbjct: 58 RKVDTANISRARLHQQLAESEAEFTHLLLSLGERSLPGR 96 >ref|XP_011086778.1| 65-kDa microtubule-associated protein 8 isoform X1 [Sesamum indicum] Length = 595 Score = 59.7 bits (143), Expect = 2e-07 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -1 Query: 350 RHCHTANISRARLHQRLVKSKAEFTYLLLSLGERSLTGR 234 R TANISRARLHQ+L +S+AEFT+LLLSLGERSL GR Sbjct: 58 RKVDTANISRARLHQQLAESEAEFTHLLLSLGERSLPGR 96 >ref|XP_002303801.2| hypothetical protein POPTR_0003s17180g [Populus trichocarpa] gb|PNT46124.1| hypothetical protein POPTR_003G173300v3 [Populus trichocarpa] Length = 592 Score = 58.2 bits (139), Expect = 6e-07 Identities = 33/56 (58%), Positives = 41/56 (73%) Frame = -1 Query: 401 KIHSTLQQHEEEKWKESRHCHTANISRARLHQRLVKSKAEFTYLLLSLGERSLTGR 234 K+ L+Q E ++ R +ANISRARLHQ L +S+AEFT+LLLSLGERSL GR Sbjct: 41 KVLHDLEQECLEVYR--RKVDSANISRARLHQELAESEAEFTHLLLSLGERSLPGR 94 >ref|XP_020539268.1| 65-kDa microtubule-associated protein 8 isoform X3 [Jatropha curcas] Length = 494 Score = 57.8 bits (138), Expect = 8e-07 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 Query: 350 RHCHTANISRARLHQRLVKSKAEFTYLLLSLGERSLTGR 234 R +ANISRARLHQ L +S+AEFT+LLLSLGERSL GR Sbjct: 58 RKVDSANISRARLHQELAESEAEFTHLLLSLGERSLPGR 96 >ref|XP_020539267.1| 65-kDa microtubule-associated protein 8 isoform X2 [Jatropha curcas] Length = 502 Score = 57.8 bits (138), Expect = 8e-07 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 Query: 350 RHCHTANISRARLHQRLVKSKAEFTYLLLSLGERSLTGR 234 R +ANISRARLHQ L +S+AEFT+LLLSLGERSL GR Sbjct: 58 RKVDSANISRARLHQELAESEAEFTHLLLSLGERSLPGR 96 >gb|KDP26794.1| hypothetical protein JCGZ_17952 [Jatropha curcas] Length = 567 Score = 57.8 bits (138), Expect = 8e-07 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 Query: 350 RHCHTANISRARLHQRLVKSKAEFTYLLLSLGERSLTGR 234 R +ANISRARLHQ L +S+AEFT+LLLSLGERSL GR Sbjct: 30 RKVDSANISRARLHQELAESEAEFTHLLLSLGERSLPGR 68 >emb|CBI27647.3| unnamed protein product, partial [Vitis vinifera] Length = 567 Score = 57.8 bits (138), Expect = 8e-07 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 Query: 350 RHCHTANISRARLHQRLVKSKAEFTYLLLSLGERSLTGR 234 R +ANISRARLHQ L +S+AEFT+LLLSLGERSL GR Sbjct: 30 RKVDSANISRARLHQELAESEAEFTHLLLSLGERSLPGR 68 >gb|EEF47478.1| PLE, putative [Ricinus communis] Length = 583 Score = 57.8 bits (138), Expect = 8e-07 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 Query: 350 RHCHTANISRARLHQRLVKSKAEFTYLLLSLGERSLTGR 234 R +ANISRARLHQ L +S+AEFT+LLLSLGERSL GR Sbjct: 45 RKVDSANISRARLHQELAESEAEFTHLLLSLGERSLPGR 83 >ref|XP_011020730.1| PREDICTED: 65-kDa microtubule-associated protein 8-like [Populus euphratica] Length = 592 Score = 57.8 bits (138), Expect = 8e-07 Identities = 33/56 (58%), Positives = 40/56 (71%) Frame = -1 Query: 401 KIHSTLQQHEEEKWKESRHCHTANISRARLHQRLVKSKAEFTYLLLSLGERSLTGR 234 K+ L+Q E ++ R ANISRARLHQ L +S+AEFT+LLLSLGERSL GR Sbjct: 41 KVLHDLEQECLEVYR--RKVDNANISRARLHQELAESEAEFTHLLLSLGERSLPGR 94 >ref|XP_021644335.1| 65-kDa microtubule-associated protein 8 isoform X1 [Hevea brasiliensis] ref|XP_021644337.1| 65-kDa microtubule-associated protein 8 isoform X2 [Hevea brasiliensis] Length = 595 Score = 57.8 bits (138), Expect = 8e-07 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 Query: 350 RHCHTANISRARLHQRLVKSKAEFTYLLLSLGERSLTGR 234 R +ANISRARLHQ L +S+AEFT+LLLSLGERSL GR Sbjct: 58 RKVDSANISRARLHQELAESEAEFTHLLLSLGERSLPGR 96 >ref|XP_021629951.1| 65-kDa microtubule-associated protein 8 isoform X1 [Manihot esculenta] gb|OAY34338.1| hypothetical protein MANES_12G012200 [Manihot esculenta] Length = 595 Score = 57.8 bits (138), Expect = 8e-07 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 Query: 350 RHCHTANISRARLHQRLVKSKAEFTYLLLSLGERSLTGR 234 R +ANISRARLHQ L +S+AEFT+LLLSLGERSL GR Sbjct: 58 RKVDSANISRARLHQELAESEAEFTHLLLSLGERSLPGR 96 >ref|XP_012085669.1| 65-kDa microtubule-associated protein 8 isoform X1 [Jatropha curcas] Length = 595 Score = 57.8 bits (138), Expect = 8e-07 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 Query: 350 RHCHTANISRARLHQRLVKSKAEFTYLLLSLGERSLTGR 234 R +ANISRARLHQ L +S+AEFT+LLLSLGERSL GR Sbjct: 58 RKVDSANISRARLHQELAESEAEFTHLLLSLGERSLPGR 96 >ref|XP_002271779.2| PREDICTED: 65-kDa microtubule-associated protein 8 [Vitis vinifera] Length = 595 Score = 57.8 bits (138), Expect = 8e-07 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 Query: 350 RHCHTANISRARLHQRLVKSKAEFTYLLLSLGERSLTGR 234 R +ANISRARLHQ L +S+AEFT+LLLSLGERSL GR Sbjct: 58 RKVDSANISRARLHQELAESEAEFTHLLLSLGERSLPGR 96 >ref|XP_015572131.1| PREDICTED: 65-kDa microtubule-associated protein 8 [Ricinus communis] Length = 596 Score = 57.8 bits (138), Expect = 8e-07 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 Query: 350 RHCHTANISRARLHQRLVKSKAEFTYLLLSLGERSLTGR 234 R +ANISRARLHQ L +S+AEFT+LLLSLGERSL GR Sbjct: 58 RKVDSANISRARLHQELAESEAEFTHLLLSLGERSLPGR 96 >dbj|GAV66499.1| MAP65_ASE1 domain-containing protein [Cephalotus follicularis] Length = 595 Score = 57.4 bits (137), Expect = 1e-06 Identities = 33/56 (58%), Positives = 40/56 (71%) Frame = -1 Query: 401 KIHSTLQQHEEEKWKESRHCHTANISRARLHQRLVKSKAEFTYLLLSLGERSLTGR 234 K+ L+Q E ++ R ANISRARLHQ L +S+AEFT+LLLSLGERSL GR Sbjct: 43 KVMLDLEQECLEVYR--RKVDRANISRARLHQELAESEAEFTHLLLSLGERSLPGR 96 >ref|XP_011002137.1| PREDICTED: 65-kDa microtubule-associated protein 8-like isoform X2 [Populus euphratica] Length = 600 Score = 57.4 bits (137), Expect = 1e-06 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = -1 Query: 350 RHCHTANISRARLHQRLVKSKAEFTYLLLSLGERSLTGR 234 R ANISRARLHQ L +S+AEFT+LLLSLGERSL GR Sbjct: 56 RKVDNANISRARLHQELAESEAEFTHLLLSLGERSLPGR 94 >ref|XP_011002136.1| PREDICTED: 65-kDa microtubule-associated protein 8-like isoform X1 [Populus euphratica] Length = 602 Score = 57.4 bits (137), Expect = 1e-06 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = -1 Query: 350 RHCHTANISRARLHQRLVKSKAEFTYLLLSLGERSLTGR 234 R ANISRARLHQ L +S+AEFT+LLLSLGERSL GR Sbjct: 56 RKVDNANISRARLHQELAESEAEFTHLLLSLGERSLPGR 94