BLASTX nr result
ID: Rehmannia32_contig00010759
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00010759 (408 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022846325.1| outer envelope pore protein 16, chloroplasti... 72 3e-13 gb|PIN24376.1| hypothetical protein CDL12_02909 [Handroanthus im... 70 2e-12 ref|XP_012827871.1| PREDICTED: outer envelope pore protein 16, c... 69 3e-12 ref|XP_002532855.1| PREDICTED: outer envelope pore protein 16, c... 68 9e-12 ref|XP_021674035.1| outer envelope pore protein 16, chloroplasti... 67 2e-11 ref|XP_015874087.1| PREDICTED: outer envelope pore protein 16, c... 66 2e-11 gb|PHU13740.1| Outer envelope pore protein 16, chloroplastic [Ca... 66 5e-11 ref|XP_016575865.1| PREDICTED: outer envelope pore protein 16, c... 66 5e-11 dbj|GAU17335.1| hypothetical protein TSUD_110520 [Trifolium subt... 64 5e-11 ref|XP_002283749.1| PREDICTED: outer envelope pore protein 16, c... 66 7e-11 ref|XP_024028082.1| outer envelope pore protein 16, chloroplasti... 65 9e-11 gb|PNX83924.1| outer envelope pore protein chloroplastic-like, p... 64 1e-10 dbj|GAU17337.1| hypothetical protein TSUD_110540 [Trifolium subt... 65 1e-10 ref|XP_004487008.1| PREDICTED: outer envelope pore protein 16, c... 65 1e-10 gb|EXC10651.1| hypothetical protein L484_025232 [Morus notabilis] 64 2e-10 emb|CDP09055.1| unnamed protein product [Coffea canephora] 65 2e-10 gb|AFK37994.1| unknown [Lotus japonicus] 64 2e-10 ref|XP_013465403.1| outer envelope pore protein [Medicago trunca... 64 3e-10 sp|Q41050.1|OEP16_PEA RecName: Full=Outer envelope pore protein ... 64 3e-10 ref|XP_012075960.1| outer envelope pore protein 16, chloroplasti... 64 3e-10 >ref|XP_022846325.1| outer envelope pore protein 16, chloroplastic [Olea europaea var. sylvestris] Length = 169 Score = 72.4 bits (176), Expect = 3e-13 Identities = 39/55 (70%), Positives = 43/55 (78%), Gaps = 2/55 (3%) Frame = -2 Query: 161 REFLSDNYNMPH--LIVDLGHPFLNLTVDGFLKIGTVAAAKVVAEDTYDVVKRGS 3 R LS + N P LIVDLG+PFLNLT DGFLKIGTVAAA+V AE+ Y VVKRGS Sbjct: 3 RSVLSGSINSPKVDLIVDLGNPFLNLTFDGFLKIGTVAAARVAAEEAYYVVKRGS 57 >gb|PIN24376.1| hypothetical protein CDL12_02909 [Handroanthus impetiginosus] Length = 146 Score = 69.7 bits (169), Expect = 2e-12 Identities = 33/41 (80%), Positives = 39/41 (95%) Frame = -2 Query: 125 LIVDLGHPFLNLTVDGFLKIGTVAAAKVVAEDTYDVVKRGS 3 L VD+G+PFLNLT++GFL+IGTVAAAKVVAE+TY VVKRGS Sbjct: 17 LTVDVGNPFLNLTINGFLRIGTVAAAKVVAEETYHVVKRGS 57 >ref|XP_012827871.1| PREDICTED: outer envelope pore protein 16, chloroplastic [Erythranthe guttata] gb|EYU18967.1| hypothetical protein MIMGU_mgv1a015773mg [Erythranthe guttata] Length = 146 Score = 69.3 bits (168), Expect = 3e-12 Identities = 36/55 (65%), Positives = 42/55 (76%), Gaps = 2/55 (3%) Frame = -2 Query: 161 REFLSDNYNMPH--LIVDLGHPFLNLTVDGFLKIGTVAAAKVVAEDTYDVVKRGS 3 R L ++ P LIVD+G+PFLN T+DGFLKIGTVAA KVVAE+ Y VVKRGS Sbjct: 3 RSTLVGGFSSPRVDLIVDMGNPFLNATLDGFLKIGTVAAGKVVAEEVYGVVKRGS 57 >ref|XP_002532855.1| PREDICTED: outer envelope pore protein 16, chloroplastic [Ricinus communis] gb|EEF29533.1| conserved hypothetical protein [Ricinus communis] Length = 146 Score = 68.2 bits (165), Expect = 9e-12 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -2 Query: 125 LIVDLGHPFLNLTVDGFLKIGTVAAAKVVAEDTYDVVKRGS 3 +++D+GHPFLNLTVDGFLKIGTV A +V+AED Y VKRGS Sbjct: 17 VVIDMGHPFLNLTVDGFLKIGTVGATRVLAEDAYYAVKRGS 57 >ref|XP_021674035.1| outer envelope pore protein 16, chloroplastic [Hevea brasiliensis] Length = 146 Score = 67.4 bits (163), Expect = 2e-11 Identities = 31/39 (79%), Positives = 37/39 (94%) Frame = -2 Query: 119 VDLGHPFLNLTVDGFLKIGTVAAAKVVAEDTYDVVKRGS 3 +D+G+PFLNLTVDGFLKIGTVAAA+V+AED Y VVKRG+ Sbjct: 19 IDMGNPFLNLTVDGFLKIGTVAAARVLAEDAYYVVKRGN 57 >ref|XP_015874087.1| PREDICTED: outer envelope pore protein 16, chloroplastic [Ziziphus jujuba] Length = 107 Score = 66.2 bits (160), Expect = 2e-11 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = -2 Query: 125 LIVDLGHPFLNLTVDGFLKIGTVAAAKVVAEDTYDVVKRGS 3 + +D+G+PFLNLTVDGFLKIGTVAA + VAED Y +VK+GS Sbjct: 17 VFIDMGNPFLNLTVDGFLKIGTVAATRAVAEDAYHIVKKGS 57 >gb|PHU13740.1| Outer envelope pore protein 16, chloroplastic [Capsicum chinense] Length = 146 Score = 66.2 bits (160), Expect = 5e-11 Identities = 29/41 (70%), Positives = 37/41 (90%) Frame = -2 Query: 125 LIVDLGHPFLNLTVDGFLKIGTVAAAKVVAEDTYDVVKRGS 3 +++D+G+PFLN TVD FLKIGTVAA K VAE+TY++VKRGS Sbjct: 17 VVIDMGNPFLNHTVDAFLKIGTVAATKTVAEETYEIVKRGS 57 >ref|XP_016575865.1| PREDICTED: outer envelope pore protein 16, chloroplastic [Capsicum annuum] gb|PHT44732.1| Outer envelope pore protein 16, chloroplastic [Capsicum baccatum] gb|PHT78094.1| Outer envelope pore protein 16, chloroplastic [Capsicum annuum] Length = 146 Score = 66.2 bits (160), Expect = 5e-11 Identities = 29/41 (70%), Positives = 37/41 (90%) Frame = -2 Query: 125 LIVDLGHPFLNLTVDGFLKIGTVAAAKVVAEDTYDVVKRGS 3 +++D+G+PFLN TVD FLKIGTVAA K VAE+TY++VKRGS Sbjct: 17 VVIDMGNPFLNHTVDAFLKIGTVAATKTVAEETYEIVKRGS 57 >dbj|GAU17335.1| hypothetical protein TSUD_110520 [Trifolium subterraneum] Length = 77 Score = 64.3 bits (155), Expect = 5e-11 Identities = 27/39 (69%), Positives = 36/39 (92%) Frame = -2 Query: 119 VDLGHPFLNLTVDGFLKIGTVAAAKVVAEDTYDVVKRGS 3 +D+G+PFLNLT+DGFLKIGTVAA + +AEDTY +V++GS Sbjct: 19 IDMGNPFLNLTLDGFLKIGTVAATRALAEDTYHIVRKGS 57 >ref|XP_002283749.1| PREDICTED: outer envelope pore protein 16, chloroplastic [Vitis vinifera] Length = 146 Score = 65.9 bits (159), Expect = 7e-11 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = -2 Query: 125 LIVDLGHPFLNLTVDGFLKIGTVAAAKVVAEDTYDVVKRGS 3 +++D+G+PFLNLTVDGFLKIGTVAAA+ AE+ Y VVKRGS Sbjct: 17 VMIDMGNPFLNLTVDGFLKIGTVAAARAAAEEAYYVVKRGS 57 >ref|XP_024028082.1| outer envelope pore protein 16, chloroplastic [Morus notabilis] Length = 146 Score = 65.5 bits (158), Expect = 9e-11 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = -2 Query: 119 VDLGHPFLNLTVDGFLKIGTVAAAKVVAEDTYDVVKRGS 3 +D G PF+NLTVDGFLKIGT+AA +VVAEDTY +VK+GS Sbjct: 19 IDTGIPFINLTVDGFLKIGTIAATRVVAEDTYHIVKKGS 57 >gb|PNX83924.1| outer envelope pore protein chloroplastic-like, partial [Trifolium pratense] Length = 105 Score = 64.3 bits (155), Expect = 1e-10 Identities = 26/41 (63%), Positives = 38/41 (92%) Frame = -2 Query: 125 LIVDLGHPFLNLTVDGFLKIGTVAAAKVVAEDTYDVVKRGS 3 +++D+G+PFLNLT+DGFLKIGTVAA++ +AED Y +V++GS Sbjct: 17 VVIDMGNPFLNLTLDGFLKIGTVAASRALAEDAYHIVRKGS 57 >dbj|GAU17337.1| hypothetical protein TSUD_110540 [Trifolium subterraneum] Length = 125 Score = 64.7 bits (156), Expect = 1e-10 Identities = 26/41 (63%), Positives = 38/41 (92%) Frame = -2 Query: 125 LIVDLGHPFLNLTVDGFLKIGTVAAAKVVAEDTYDVVKRGS 3 +++D+G+P+LNLTVDGFLKIGTVAA + +AEDTY +V++G+ Sbjct: 17 VVIDMGNPYLNLTVDGFLKIGTVAATRALAEDTYHIVRKGT 57 >ref|XP_004487008.1| PREDICTED: outer envelope pore protein 16, chloroplastic [Cicer arietinum] Length = 146 Score = 65.1 bits (157), Expect = 1e-10 Identities = 27/41 (65%), Positives = 37/41 (90%) Frame = -2 Query: 125 LIVDLGHPFLNLTVDGFLKIGTVAAAKVVAEDTYDVVKRGS 3 +++D+G+PFLNLTVDGFLKIG VAA + VAEDTY ++++GS Sbjct: 17 VVIDMGNPFLNLTVDGFLKIGAVAATRSVAEDTYHIIRKGS 57 >gb|EXC10651.1| hypothetical protein L484_025232 [Morus notabilis] Length = 124 Score = 64.3 bits (155), Expect = 2e-10 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = -2 Query: 119 VDLGHPFLNLTVDGFLKIGTVAAAKVVAEDTYDVVKRGS 3 +D G PF+NLTVDGFLKIGT+AA +VVAEDTY +VK+G+ Sbjct: 19 IDTGIPFINLTVDGFLKIGTIAATRVVAEDTYHIVKKGT 57 >emb|CDP09055.1| unnamed protein product [Coffea canephora] Length = 146 Score = 64.7 bits (156), Expect = 2e-10 Identities = 33/55 (60%), Positives = 40/55 (72%), Gaps = 2/55 (3%) Frame = -2 Query: 161 REFLSDNYNMPH--LIVDLGHPFLNLTVDGFLKIGTVAAAKVVAEDTYDVVKRGS 3 R +S ++ P LI+D G+PFLNLTVDGFLKIG VAA K AE+ Y +VKRGS Sbjct: 3 RTRISGTFSSPKVDLIIDTGNPFLNLTVDGFLKIGCVAATKAAAEEAYYIVKRGS 57 >gb|AFK37994.1| unknown [Lotus japonicus] Length = 127 Score = 63.9 bits (154), Expect = 2e-10 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = -2 Query: 119 VDLGHPFLNLTVDGFLKIGTVAAAKVVAEDTYDVVKRGS 3 +D+G+PFLNLTVDGFLKIG VAA + AEDTY ++K+GS Sbjct: 19 IDMGNPFLNLTVDGFLKIGAVAATRAAAEDTYHIIKKGS 57 >ref|XP_013465403.1| outer envelope pore protein [Medicago truncatula] gb|KEH39438.1| outer envelope pore protein [Medicago truncatula] Length = 114 Score = 63.5 bits (153), Expect = 3e-10 Identities = 26/41 (63%), Positives = 37/41 (90%) Frame = -2 Query: 125 LIVDLGHPFLNLTVDGFLKIGTVAAAKVVAEDTYDVVKRGS 3 +++D+G+PFLNL VDGFLKIGTVAA + +AEDT+ +V++GS Sbjct: 17 VVIDMGNPFLNLAVDGFLKIGTVAATRALAEDTFHIVRKGS 57 >sp|Q41050.1|OEP16_PEA RecName: Full=Outer envelope pore protein 16, chloroplastic; AltName: Full=Chloroplastic outer envelope pore protein of 16 kDa emb|CAA97910.1| core protein [Pisum sativum] Length = 146 Score = 64.3 bits (155), Expect = 3e-10 Identities = 30/55 (54%), Positives = 42/55 (76%), Gaps = 2/55 (3%) Frame = -2 Query: 161 REFLSDNYNMPHL--IVDLGHPFLNLTVDGFLKIGTVAAAKVVAEDTYDVVKRGS 3 R S + + P L ++D+G+PFLNLTVDGFLKIG VAA + VAEDT+ ++++GS Sbjct: 3 RSSFSGSLSSPKLDVVIDMGNPFLNLTVDGFLKIGAVAATRSVAEDTFHIIRKGS 57 >ref|XP_012075960.1| outer envelope pore protein 16, chloroplastic isoform X2 [Jatropha curcas] gb|KDP34497.1| hypothetical protein JCGZ_11047 [Jatropha curcas] Length = 146 Score = 64.3 bits (155), Expect = 3e-10 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = -2 Query: 119 VDLGHPFLNLTVDGFLKIGTVAAAKVVAEDTYDVVKRGS 3 +D+G+PFLNLTVDGFLKIGTVAA + +AED Y VVKRG+ Sbjct: 19 IDMGNPFLNLTVDGFLKIGTVAATRALAEDAYYVVKRGN 57