BLASTX nr result
ID: Rehmannia32_contig00010658
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00010658 (413 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN17198.1| hypothetical protein CDL12_10143 [Handroanthus im... 55 4e-06 >gb|PIN17198.1| hypothetical protein CDL12_10143 [Handroanthus impetiginosus] Length = 285 Score = 55.1 bits (131), Expect = 4e-06 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = +3 Query: 3 RTYIGKGWSAFQKDNDVGFKDSYYIFTFETERSSKTIHVQISHVK 137 R YIG GW +FQKDN +G KDS IFTF TER S+TI+V+I VK Sbjct: 240 RKYIGSGWWSFQKDNKMGAKDS-CIFTFPTERLSRTINVKILLVK 283