BLASTX nr result
ID: Rehmannia32_contig00010424
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00010424 (364 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012846075.1| PREDICTED: methionine aminopeptidase 1B, chl... 73 1e-12 gb|PIN09499.1| putative methionine aminopeptidase [Handroanthus ... 72 3e-12 ref|XP_011070833.1| methionine aminopeptidase 1B, chloroplastic ... 65 6e-10 >ref|XP_012846075.1| PREDICTED: methionine aminopeptidase 1B, chloroplastic [Erythranthe guttata] gb|EYU29943.1| hypothetical protein MIMGU_mgv1a008750mg [Erythranthe guttata] gb|EYU29944.1| hypothetical protein MIMGU_mgv1a008750mg [Erythranthe guttata] Length = 363 Score = 73.2 bits (178), Expect = 1e-12 Identities = 41/75 (54%), Positives = 47/75 (62%) Frame = +3 Query: 138 VHGEARLSASSTLLMGTSLASPSSSPLYNLKGTSRLSVHAKKISGXXXXXXXXXXXXXXT 317 VHGE +LSASSTLLMG LAS S P Y+LK L + +K++SG T Sbjct: 16 VHGETKLSASSTLLMGAPLASRSPCPPYDLKMARPLVIQSKRLSGLEESIRIRRERELQT 75 Query: 318 SPTSKRRPALRRGKV 362 S TSKRRPALRRGKV Sbjct: 76 STTSKRRPALRRGKV 90 >gb|PIN09499.1| putative methionine aminopeptidase [Handroanthus impetiginosus] Length = 369 Score = 72.0 bits (175), Expect = 3e-12 Identities = 41/75 (54%), Positives = 46/75 (61%) Frame = +3 Query: 138 VHGEARLSASSTLLMGTSLASPSSSPLYNLKGTSRLSVHAKKISGXXXXXXXXXXXXXXT 317 VHGEA+LSAS++ LMG L S + SPL N K RL V +KKISG Sbjct: 22 VHGEAKLSASASFLMGAPLPSCNPSPLSNSKVARRLVVRSKKISGLDEYIRIQKERQLRA 81 Query: 318 SPTSKRRPALRRGKV 362 SPTSKRRP LRRGKV Sbjct: 82 SPTSKRRPPLRRGKV 96 >ref|XP_011070833.1| methionine aminopeptidase 1B, chloroplastic [Sesamum indicum] Length = 371 Score = 65.5 bits (158), Expect = 6e-10 Identities = 41/75 (54%), Positives = 46/75 (61%), Gaps = 1/75 (1%) Frame = +3 Query: 141 HGEARLSASSTLLMGTSLASPSSSPLYNLKGTSRLS-VHAKKISGXXXXXXXXXXXXXXT 317 HGE LSASSTLLMG+ L S +SS + K T RL VH+K+ISG T Sbjct: 24 HGEGILSASSTLLMGSPLGSRNSSSPSSPKVTKRLLLVHSKRISGLEEAIRIRRERELRT 83 Query: 318 SPTSKRRPALRRGKV 362 SPTSKR P LRRGKV Sbjct: 84 SPTSKRMPPLRRGKV 98