BLASTX nr result
ID: Rehmannia32_contig00009760
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00009760 (487 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTG05717.1| putative translation machinery-associated protein... 62 4e-10 gb|EPS74477.1| hypothetical protein M569_00288 [Genlisea aurea] 62 4e-10 emb|CAH59409.1| hypothetical protein [Plantago major] 61 1e-09 gb|OTG27072.1| putative translation machinery associated TMA7 [H... 62 2e-09 ref|XP_023760764.1| translation machinery-associated protein 7 [... 61 2e-09 gb|PIN04459.1| hypothetical protein CDL12_23005 [Handroanthus im... 60 3e-09 gb|PIN06439.1| hypothetical protein CDL12_21008 [Handroanthus im... 59 6e-09 gb|KVH92970.1| Translation machinery associated TMA7, partial [C... 60 9e-09 gb|PON34983.1| Translation machinery associated TMA [Parasponia ... 59 1e-08 ref|XP_022947069.1| translation machinery-associated protein 7-l... 58 3e-08 ref|XP_023534319.1| translation machinery-associated protein 7-l... 57 4e-08 gb|PON86399.1| Translation machinery associated TMA [Trema orien... 57 5e-08 gb|OAY52947.1| hypothetical protein MANES_04G124600 [Manihot esc... 57 5e-08 gb|KHG00266.1| Translation machinery-associated 7 [Gossypium arb... 57 5e-08 gb|ADK13061.1| conserved hypothetical protein 4 [Hevea brasilien... 57 5e-08 gb|OIW11873.1| hypothetical protein TanjilG_25786 [Lupinus angus... 57 7e-08 ref|NP_563969.1| Translation machinery associated TMA7 [Arabidop... 57 7e-08 ref|XP_022980452.1| translation machinery-associated protein 7-l... 57 9e-08 gb|ONI15933.1| hypothetical protein PRUPE_3G069900 [Prunus persica] 56 1e-07 dbj|GAU13845.1| hypothetical protein TSUD_261720 [Trifolium subt... 56 1e-07 >gb|OTG05717.1| putative translation machinery-associated protein 7 [Helianthus annuus] Length = 63 Score = 62.4 bits (150), Expect = 4e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 392 MSTKQGGKAKPLKQPKAEKKEYDEIDKANI 303 MS+KQGGKAKPLKQPKAEKKEYDEIDKANI Sbjct: 1 MSSKQGGKAKPLKQPKAEKKEYDEIDKANI 30 >gb|EPS74477.1| hypothetical protein M569_00288 [Genlisea aurea] Length = 64 Score = 62.4 bits (150), Expect = 4e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 392 MSTKQGGKAKPLKQPKAEKKEYDEIDKANI 303 MS+KQGGKAKPLKQPKAEKKEYDEIDKANI Sbjct: 1 MSSKQGGKAKPLKQPKAEKKEYDEIDKANI 30 >emb|CAH59409.1| hypothetical protein [Plantago major] Length = 63 Score = 61.2 bits (147), Expect = 1e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 392 MSTKQGGKAKPLKQPKAEKKEYDEIDKANI 303 MS+KQGGKAKPLKQPK+EKKEYDEIDKANI Sbjct: 1 MSSKQGGKAKPLKQPKSEKKEYDEIDKANI 30 >gb|OTG27072.1| putative translation machinery associated TMA7 [Helianthus annuus] Length = 104 Score = 62.0 bits (149), Expect = 2e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 392 MSTKQGGKAKPLKQPKAEKKEYDEIDKANI 303 MS+KQGGKAKPLKQPKAEKKEYDE+DKANI Sbjct: 42 MSSKQGGKAKPLKQPKAEKKEYDEVDKANI 71 >ref|XP_023760764.1| translation machinery-associated protein 7 [Lactuca sativa] gb|PLY87080.1| hypothetical protein LSAT_5X130340 [Lactuca sativa] gb|PLY98555.1| hypothetical protein LSAT_1X35180 [Lactuca sativa] Length = 63 Score = 60.8 bits (146), Expect = 2e-09 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 392 MSTKQGGKAKPLKQPKAEKKEYDEIDKANI 303 MS+KQGGKAKPLKQPK+EKKEYDE+DKANI Sbjct: 1 MSSKQGGKAKPLKQPKSEKKEYDEVDKANI 30 >gb|PIN04459.1| hypothetical protein CDL12_23005 [Handroanthus impetiginosus] Length = 64 Score = 60.1 bits (144), Expect = 3e-09 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 392 MSTKQGGKAKPLKQPKAEKKEYDEIDKANI 303 MS+KQGGKAKPL+QPK+EKKEYDEIDKANI Sbjct: 1 MSSKQGGKAKPLRQPKSEKKEYDEIDKANI 30 >gb|PIN06439.1| hypothetical protein CDL12_21008 [Handroanthus impetiginosus] Length = 64 Score = 59.3 bits (142), Expect = 6e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 392 MSTKQGGKAKPLKQPKAEKKEYDEIDKANI 303 MS+KQGGKAKPL QPKA+KKEYDEIDKANI Sbjct: 1 MSSKQGGKAKPLNQPKADKKEYDEIDKANI 30 >gb|KVH92970.1| Translation machinery associated TMA7, partial [Cynara cardunculus var. scolymus] Length = 122 Score = 60.5 bits (145), Expect = 9e-09 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 392 MSTKQGGKAKPLKQPKAEKKEYDEIDKANI 303 MS+KQGGKAKPLKQPKAEKKEYDE+DKAN+ Sbjct: 1 MSSKQGGKAKPLKQPKAEKKEYDEMDKANL 30 >gb|PON34983.1| Translation machinery associated TMA [Parasponia andersonii] Length = 64 Score = 58.5 bits (140), Expect = 1e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 392 MSTKQGGKAKPLKQPKAEKKEYDEIDKANI 303 MS+KQGGKAKPLKQPKA+KKEYDE+D ANI Sbjct: 1 MSSKQGGKAKPLKQPKADKKEYDEVDMANI 30 >ref|XP_022947069.1| translation machinery-associated protein 7-like [Cucurbita moschata] ref|XP_022947070.1| translation machinery-associated protein 7-like [Cucurbita moschata] ref|XP_022947071.1| translation machinery-associated protein 7-like [Cucurbita moschata] ref|XP_022947072.1| translation machinery-associated protein 7-like [Cucurbita moschata] ref|XP_022947073.1| translation machinery-associated protein 7-like [Cucurbita moschata] ref|XP_022971147.1| translation machinery-associated protein 7-like [Cucurbita maxima] ref|XP_022971149.1| translation machinery-associated protein 7-like [Cucurbita maxima] ref|XP_022971150.1| translation machinery-associated protein 7-like [Cucurbita maxima] ref|XP_022971151.1| translation machinery-associated protein 7-like [Cucurbita maxima] ref|XP_022971152.1| translation machinery-associated protein 7-like [Cucurbita maxima] Length = 64 Score = 57.8 bits (138), Expect = 3e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 392 MSTKQGGKAKPLKQPKAEKKEYDEIDKANI 303 MS+KQGGKAKPLKQPKA+KKEYDE+D AN+ Sbjct: 1 MSSKQGGKAKPLKQPKADKKEYDEVDMANL 30 >ref|XP_023534319.1| translation machinery-associated protein 7-like [Cucurbita pepo subsp. pepo] ref|XP_023534320.1| translation machinery-associated protein 7-like [Cucurbita pepo subsp. pepo] ref|XP_023534321.1| translation machinery-associated protein 7-like [Cucurbita pepo subsp. pepo] Length = 64 Score = 57.4 bits (137), Expect = 4e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 392 MSTKQGGKAKPLKQPKAEKKEYDEIDKANI 303 MS+KQGGKAKPLKQPKA+KKEYDE+D AN+ Sbjct: 1 MSSKQGGKAKPLKQPKADKKEYDEVDMANM 30 >gb|PON86399.1| Translation machinery associated TMA [Trema orientalis] Length = 64 Score = 57.0 bits (136), Expect = 5e-08 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 392 MSTKQGGKAKPLKQPKAEKKEYDEIDKANI 303 MS+KQGGKAKPLKQPK +KKEYDE+D ANI Sbjct: 1 MSSKQGGKAKPLKQPKVDKKEYDEVDMANI 30 >gb|OAY52947.1| hypothetical protein MANES_04G124600 [Manihot esculenta] Length = 64 Score = 57.0 bits (136), Expect = 5e-08 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 392 MSTKQGGKAKPLKQPKAEKKEYDEIDKANI 303 MS+KQGGKAKPLKQPKA+KKEYDE D ANI Sbjct: 1 MSSKQGGKAKPLKQPKADKKEYDETDMANI 30 >gb|KHG00266.1| Translation machinery-associated 7 [Gossypium arboreum] Length = 64 Score = 57.0 bits (136), Expect = 5e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 392 MSTKQGGKAKPLKQPKAEKKEYDEIDKANI 303 MS+KQGGKAKPLKQPKAEKKEYDE D ANI Sbjct: 1 MSSKQGGKAKPLKQPKAEKKEYDEHDLANI 30 >gb|ADK13061.1| conserved hypothetical protein 4 [Hevea brasiliensis] Length = 64 Score = 57.0 bits (136), Expect = 5e-08 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 392 MSTKQGGKAKPLKQPKAEKKEYDEIDKANI 303 MS+KQGGKAKPLKQPKAEKK+YDE D ANI Sbjct: 1 MSSKQGGKAKPLKQPKAEKKDYDETDTANI 30 >gb|OIW11873.1| hypothetical protein TanjilG_25786 [Lupinus angustifolius] Length = 64 Score = 56.6 bits (135), Expect = 7e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 392 MSTKQGGKAKPLKQPKAEKKEYDEIDKANI 303 MSTKQGGKAKPLK+PK++KK+YDEID ANI Sbjct: 1 MSTKQGGKAKPLKKPKSDKKDYDEIDMANI 30 >ref|NP_563969.1| Translation machinery associated TMA7 [Arabidopsis thaliana] ref|XP_023645624.1| translation machinery-associated protein 7 [Capsella rubella] gb|AAD39655.1|AC007591_20 ESTs gb|AA650895, gb|AA720043 and gb|R29777 come from this gene [Arabidopsis thaliana] gb|AAG54006.1|AF336925_1 unknown protein [Arabidopsis thaliana] gb|AAK76677.1| unknown protein [Arabidopsis thaliana] gb|AAL32782.1| Unknown protein [Arabidopsis thaliana] gb|AAM13386.1| unknown protein [Arabidopsis thaliana] gb|AAM64267.1| unknown [Arabidopsis thaliana] gb|EFH69116.1| hypothetical protein ARALYDRAFT_471721 [Arabidopsis lyrata subsp. lyrata] gb|AEE29297.1| Translation machinery associated TMA7 [Arabidopsis thaliana] gb|OAP14198.1| hypothetical protein AXX17_AT1G16000 [Arabidopsis thaliana] Length = 64 Score = 56.6 bits (135), Expect = 7e-08 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 392 MSTKQGGKAKPLKQPKAEKKEYDEIDKANI 303 MS+KQGGKAKPLKQPKA+KKEYDE D ANI Sbjct: 1 MSSKQGGKAKPLKQPKADKKEYDETDLANI 30 >ref|XP_022980452.1| translation machinery-associated protein 7-like [Cucurbita maxima] Length = 101 Score = 57.4 bits (137), Expect = 9e-08 Identities = 27/40 (67%), Positives = 34/40 (85%), Gaps = 1/40 (2%) Frame = -3 Query: 419 SEP*PYNLT-MSTKQGGKAKPLKQPKAEKKEYDEIDKANI 303 + P P +++ MS+KQGGKAKPLKQPK EKK+YDE+D ANI Sbjct: 28 TRPNPNDISAMSSKQGGKAKPLKQPKVEKKDYDEVDMANI 67 >gb|ONI15933.1| hypothetical protein PRUPE_3G069900 [Prunus persica] Length = 64 Score = 56.2 bits (134), Expect = 1e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 392 MSTKQGGKAKPLKQPKAEKKEYDEIDKANI 303 MS+KQGGKAKPLKQPK+EKKEYDE D ANI Sbjct: 1 MSSKQGGKAKPLKQPKSEKKEYDESDLANI 30 >dbj|GAU13845.1| hypothetical protein TSUD_261720 [Trifolium subterraneum] gb|PNY04512.1| hypothetical protein L195_g000936 [Trifolium pratense] Length = 64 Score = 56.2 bits (134), Expect = 1e-07 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -3 Query: 392 MSTKQGGKAKPLKQPKAEKKEYDEIDKANI 303 MSTKQGGKAKPLK+PK++KK+YDE+D ANI Sbjct: 1 MSTKQGGKAKPLKKPKSDKKDYDEVDMANI 30