BLASTX nr result
ID: Rehmannia32_contig00008224
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00008224 (422 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011096330.1| glyoxysomal processing protease, glyoxysomal... 56 3e-06 gb|PIN07392.1| Peptidase Do [Handroanthus impetiginosus] 55 4e-06 >ref|XP_011096330.1| glyoxysomal processing protease, glyoxysomal [Sesamum indicum] Length = 743 Score = 55.8 bits (133), Expect = 3e-06 Identities = 30/40 (75%), Positives = 32/40 (80%), Gaps = 3/40 (7%) Frame = +2 Query: 2 EDNSKGMKGSRFAKFIADRNELLKTKVQD---GSFSNGLI 112 EDNSKG KGSRFAKFIADRNELLK VQ G+F+N LI Sbjct: 700 EDNSKGTKGSRFAKFIADRNELLKKTVQHGMAGTFTNELI 739 >gb|PIN07392.1| Peptidase Do [Handroanthus impetiginosus] Length = 744 Score = 55.5 bits (132), Expect = 4e-06 Identities = 29/40 (72%), Positives = 33/40 (82%), Gaps = 3/40 (7%) Frame = +2 Query: 2 EDNSKGMKGSRFAKFIADRNELLKTKVQD---GSFSNGLI 112 +D+SKG KGSRFAKFIADRNELLK KVQ GSF+N +I Sbjct: 701 DDDSKGTKGSRFAKFIADRNELLKMKVQHGTVGSFTNDVI 740