BLASTX nr result
ID: Rehmannia32_contig00007457
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00007457 (514 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KYP65830.1| hypothetical protein KK1_012098, partial [Cajanus... 61 3e-09 gb|KZV26181.1| hypothetical protein F511_06348 [Dorcoceras hygro... 64 1e-08 gb|KYP75925.1| hypothetical protein KK1_020137, partial [Cajanus... 60 2e-08 gb|KYP60841.1| hypothetical protein KK1_023255 [Cajanus cajan] 60 3e-08 ref|XP_022156747.1| uncharacterized protein LOC111023586 [Momord... 63 3e-08 ref|XP_010274285.1| PREDICTED: uncharacterized protein LOC104609... 62 4e-08 gb|KYP44960.1| Retrovirus-related Pol polyprotein from transposo... 62 5e-08 ref|XP_008238542.1| PREDICTED: uncharacterized protein LOC103337... 62 6e-08 gb|PON68583.1| hypothetical protein PanWU01x14_093920 [Parasponi... 58 9e-08 gb|OMO79651.1| hypothetical protein CCACVL1_13538 [Corchorus cap... 59 4e-07 gb|OMO77387.1| Reverse transcriptase, RNA-dependent DNA polymera... 59 4e-07 ref|XP_006494563.1| PREDICTED: uncharacterized protein LOC102631... 56 6e-07 gb|PRQ28223.1| putative transcription factor interactor and regu... 59 6e-07 gb|KYP40820.1| Retrovirus-related Pol polyprotein from transposo... 58 8e-07 gb|KYP60838.1| Retrovirus-related Pol polyprotein from transposo... 58 8e-07 gb|KYP41855.1| Retrovirus-related Pol polyprotein from transposo... 58 1e-06 ref|XP_010252418.1| PREDICTED: uncharacterized protein LOC104593... 58 1e-06 gb|KYP46802.1| Retrovirus-related Pol polyprotein from transposo... 58 1e-06 gb|PNX95113.1| copia-type polyprotein [Trifolium pratense] 58 2e-06 gb|PHT95902.1| hypothetical protein T459_03784 [Capsicum annuum] 55 2e-06 >gb|KYP65830.1| hypothetical protein KK1_012098, partial [Cajanus cajan] gb|KYP65864.1| hypothetical protein KK1_012139, partial [Cajanus cajan] gb|KYP65866.1| hypothetical protein KK1_012141, partial [Cajanus cajan] Length = 97 Score = 61.2 bits (147), Expect = 3e-09 Identities = 28/48 (58%), Positives = 35/48 (72%) Frame = +1 Query: 370 PRSGAAHHVTNDFTNLSIASDYNG*NKLQVGNGTGLDISHVGSSYREN 513 P SGA+HH T+D +NLSI + Y G + + +GNGTGL ISHVG SY N Sbjct: 14 PNSGASHHFTHDESNLSIKNAYTGTDSVNIGNGTGLHISHVGLSYFHN 61 >gb|KZV26181.1| hypothetical protein F511_06348 [Dorcoceras hygrometricum] Length = 706 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/44 (63%), Positives = 36/44 (81%) Frame = +1 Query: 370 PRSGAAHHVTNDFTNLSIASDYNG*NKLQVGNGTGLDISHVGSS 501 P SGA+HHVTND NLS++S+Y G +K+QVGNG GL IS++G S Sbjct: 274 PDSGASHHVTNDLGNLSVSSEYTGGSKVQVGNGAGLSISNIGES 317 >gb|KYP75925.1| hypothetical protein KK1_020137, partial [Cajanus cajan] Length = 132 Score = 60.1 bits (144), Expect = 2e-08 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = +1 Query: 370 PRSGAAHHVTNDFTNLSIASDYNG*NKLQVGNGTGLDISHVGSSY 504 P SGA+HH+T+D + LS + Y G +K+ +GNGTGLDI HVG SY Sbjct: 59 PDSGASHHITHDDSTLSTKNPYTGSDKVNIGNGTGLDIHHVGHSY 103 >gb|KYP60841.1| hypothetical protein KK1_023255 [Cajanus cajan] Length = 144 Score = 60.1 bits (144), Expect = 3e-08 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = +1 Query: 370 PRSGAAHHVTNDFTNLSIASDYNG*NKLQVGNGTGLDISHVGSSY 504 P SGA+HH+T+D + LS + Y G +K+ +GNGTGLDI HVG SY Sbjct: 15 PDSGASHHITHDDSTLSTKNTYTGSDKVNIGNGTGLDIHHVGHSY 59 >ref|XP_022156747.1| uncharacterized protein LOC111023586 [Momordica charantia] Length = 1256 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = +1 Query: 370 PRSGAAHHVTNDFTNLSIASDYNG*NKLQVGNGTGLDISHVGSS 501 P SGA +HVTNDF N S+ S Y+G K+QVGNGT L ISH+GS+ Sbjct: 246 PDSGATNHVTNDFGNFSLGSKYHGNGKIQVGNGTNLSISHIGSA 289 >ref|XP_010274285.1| PREDICTED: uncharacterized protein LOC104609611 [Nelumbo nucifera] Length = 363 Score = 62.0 bits (149), Expect = 4e-08 Identities = 36/93 (38%), Positives = 53/93 (56%), Gaps = 5/93 (5%) Frame = +1 Query: 250 VCSRWSWP-YSKEQC*K*QEL----PSIQCYVCHHT*STF*VKLVPRSGAAHHVTNDFTN 414 VC +P ++ C + EL P+ Q + + ST P SGA +H+T+D N Sbjct: 207 VCQLCGYPSHTAATCRRYLELTTNKPTKQAHTTSSSRSTHDENRYPDSGATNHMTSDLGN 266 Query: 415 LSIASDYNG*NKLQVGNGTGLDISHVGSSYREN 513 LS+ +Y+G + + +GNGTGLDISH+GSS N Sbjct: 267 LSLHDEYHGTDHILIGNGTGLDISHIGSSILNN 299 >gb|KYP44960.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 517 Score = 62.0 bits (149), Expect = 5e-08 Identities = 24/44 (54%), Positives = 37/44 (84%) Frame = +1 Query: 370 PRSGAAHHVTNDFTNLSIASDYNG*NKLQVGNGTGLDISHVGSS 501 P SGA+HH+TND +NLS+ +DY G +++++GNG+GL I H+G+S Sbjct: 349 PDSGASHHITNDESNLSVKTDYTGNDRVKIGNGSGLSIKHIGNS 392 >ref|XP_008238542.1| PREDICTED: uncharacterized protein LOC103337169 [Prunus mume] Length = 450 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/48 (60%), Positives = 37/48 (77%) Frame = +1 Query: 370 PRSGAAHHVTNDFTNLSIASDYNG*NKLQVGNGTGLDISHVGSSYREN 513 P +GA HHVT D NLSIA++YNG ++L+VGNG GL+ISHV +S N Sbjct: 358 PDTGATHHVTPDLANLSIANNYNGPDQLKVGNGNGLNISHVWTSTFSN 405 >gb|PON68583.1| hypothetical protein PanWU01x14_093920 [Parasponia andersonii] Length = 124 Score = 58.2 bits (139), Expect = 9e-08 Identities = 25/46 (54%), Positives = 32/46 (69%) Frame = +1 Query: 376 SGAAHHVTNDFTNLSIASDYNG*NKLQVGNGTGLDISHVGSSYREN 513 SGA +H T+D NL+ +Y+G NK+ +GNG GL ISHVG SY N Sbjct: 20 SGATNHATHDLANLTFGGEYHGSNKMHLGNGAGLSISHVGCSYLPN 65 >gb|OMO79651.1| hypothetical protein CCACVL1_13538 [Corchorus capsularis] Length = 475 Score = 59.3 bits (142), Expect = 4e-07 Identities = 26/44 (59%), Positives = 36/44 (81%) Frame = +1 Query: 370 PRSGAAHHVTNDFTNLSIASDYNG*NKLQVGNGTGLDISHVGSS 501 P SGA++H+T D +N+SI S+Y G ++++VGNGTGL I HVGSS Sbjct: 356 PNSGASNHLTADLSNMSIHSEYQGHDRVKVGNGTGLPIKHVGSS 399 >gb|OMO77387.1| Reverse transcriptase, RNA-dependent DNA polymerase [Corchorus capsularis] Length = 813 Score = 59.3 bits (142), Expect = 4e-07 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = +1 Query: 376 SGAAHHVTNDFTNLSIASDYNG*NKLQVGNGTGLDISHVGSS 501 SGA+HHVT D NLSIASDY+G + +Q+G+GTGL I+H G + Sbjct: 255 SGASHHVTADLKNLSIASDYDGCDAIQIGDGTGLPITHTGDT 296 >ref|XP_006494563.1| PREDICTED: uncharacterized protein LOC102631139 [Citrus sinensis] Length = 133 Score = 56.2 bits (134), Expect = 6e-07 Identities = 23/46 (50%), Positives = 34/46 (73%) Frame = +1 Query: 376 SGAAHHVTNDFTNLSIASDYNG*NKLQVGNGTGLDISHVGSSYREN 513 SGA+HH+T D +NLS+ + Y G + + +G+GTGL I+H G S+R N Sbjct: 82 SGASHHITTDLSNLSLHAPYTGSDDVMIGDGTGLSITHTGPSHRGN 127 >gb|PRQ28223.1| putative transcription factor interactor and regulator CCHC(Zn) family [Rosa chinensis] Length = 330 Score = 58.5 bits (140), Expect = 6e-07 Identities = 24/43 (55%), Positives = 31/43 (72%) Frame = +1 Query: 376 SGAAHHVTNDFTNLSIASDYNG*NKLQVGNGTGLDISHVGSSY 504 SGA HH+T+D NL+IA Y NK+ +GNG GLD+SH G+ Y Sbjct: 193 SGATHHMTSDMRNLTIAQPYTADNKITIGNGAGLDVSHTGACY 235 >gb|KYP40820.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 306 Score = 58.2 bits (139), Expect = 8e-07 Identities = 25/45 (55%), Positives = 34/45 (75%) Frame = +1 Query: 370 PRSGAAHHVTNDFTNLSIASDYNG*NKLQVGNGTGLDISHVGSSY 504 P SGA+HH+T+D + LS + Y G +K+ +GNGTGL+I HVG SY Sbjct: 27 PDSGASHHITHDDSTLSTKNTYTGSDKVNIGNGTGLNIHHVGHSY 71 >gb|KYP60838.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 324 Score = 58.2 bits (139), Expect = 8e-07 Identities = 25/45 (55%), Positives = 34/45 (75%) Frame = +1 Query: 370 PRSGAAHHVTNDFTNLSIASDYNG*NKLQVGNGTGLDISHVGSSY 504 P SGA+HH+T+D + LS + Y G +K+ +GNGTGL+I HVG SY Sbjct: 86 PDSGASHHITHDDSTLSTKNTYTGSDKVNIGNGTGLNIHHVGHSY 130 >gb|KYP41855.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 348 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = +1 Query: 379 GAAHHVTNDFTNLSIASDYNG*NKLQVGNGTGLDISHVGSS 501 GA+HH+TND NLSI SDYNG + LQV NGT ISH GS+ Sbjct: 7 GASHHITNDLHNLSIKSDYNGFDHLQVANGTTFPISHNGST 47 >ref|XP_010252418.1| PREDICTED: uncharacterized protein LOC104593993 [Nelumbo nucifera] Length = 440 Score = 57.8 bits (138), Expect = 1e-06 Identities = 34/89 (38%), Positives = 50/89 (56%), Gaps = 5/89 (5%) Frame = +1 Query: 250 VCSRWSWP-YSKEQC*K*QEL----PSIQCYVCHHT*STF*VKLVPRSGAAHHVTNDFTN 414 VC +P ++ C + EL P+ Q ++ + S P SGA +H+T+D N Sbjct: 263 VCQLCGYPGHTAATCHRYLELTANKPTKQAHIASSSRSARDENWYPNSGATNHMTSDLGN 322 Query: 415 LSIASDYNG*NKLQVGNGTGLDISHVGSS 501 LS+ +Y+G + VGNGTGLD SH+GSS Sbjct: 323 LSLHDEYHGTYHILVGNGTGLDTSHIGSS 351 >gb|KYP46802.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 787 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/48 (54%), Positives = 35/48 (72%) Frame = +1 Query: 370 PRSGAAHHVTNDFTNLSIASDYNG*NKLQVGNGTGLDISHVGSSYREN 513 P SGA++H+T+D +NLS+ S Y G + + +GN TGL ISHVG SY N Sbjct: 358 PDSGASYHITHDESNLSMKSAYTGTDSVNIGNSTGLHISHVGHSYFHN 405 >gb|PNX95113.1| copia-type polyprotein [Trifolium pratense] Length = 1376 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = +1 Query: 376 SGAAHHVTNDFTNLSIASDYNG*NKLQVGNGTGLDISHVGSS 501 SGA+HH+TND NLSI +Y+G + LQV NG L ISHVGS+ Sbjct: 305 SGASHHITNDLHNLSIKDEYHGTDNLQVANGNSLPISHVGST 346 >gb|PHT95902.1| hypothetical protein T459_03784 [Capsicum annuum] Length = 144 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/44 (50%), Positives = 32/44 (72%) Frame = +1 Query: 370 PRSGAAHHVTNDFTNLSIASDYNG*NKLQVGNGTGLDISHVGSS 501 P SGA HH+TND N+ + +Y G +++ +GNGTGL ISH G++ Sbjct: 18 PDSGATHHLTNDMQNMVVRGEYMGNDQIHIGNGTGLTISHFGNA 61